KEGG   Equus caballus (horse): 100054377Help
Entry
100054377         CDS       T01058                                 

Gene name
NDUFS5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100054377 (NDUFS5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100054377 (NDUFS5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100054377 (NDUFS5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100054377 (NDUFS5)
   05012 Parkinson disease
    100054377 (NDUFS5)
   05016 Huntington disease
    100054377 (NDUFS5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100054377 (NDUFS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ndufs5 Cmc1 UPF0203
Motif
Other DBs
NCBI-GeneID: 100054377
NCBI-ProteinID: XP_001503561
Ensembl: ENSECAG00000011681
VGNC: 20646
LinkDB All DBs
Position
2
AA seq 106 aa AA seqDB search
MPFFDVQKRLGLNLDHWMTIQSAEQPHKIPGRCHAFEKEWIECAHGIGGIRAEKECKIEF
DDFVECLLRHKTMKRLSAIRRQRDKLIKEGKYTPPPHHLGKEDPRP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcctttctttgatgtgcagaaaaggctgggccttaacttagatcactggatgacaata
caaagtgcagagcagcctcacaagattccaggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcacatggaatcggtggtatccgcgcagagaaagagtgcaagatagaattc
gatgatttcgtagagtgtctgcttcggcacaagacgatgaaacgcctgagtgccatcagg
aggcagcgggataagctaataaaggaagggaagtacacgcctccacctcaccacttgggc
aaggaggatcctaggccctga

DBGET integrated database retrieval system