KEGG   Equus caballus (horse): 100054582Help
Entry
100054582         CDS       T01058                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04020  Calcium signaling pathway
ecb04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100054582 (CACNA1E)
   04020 Calcium signaling pathway
    100054582 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100054582 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ecb04040]
    100054582 (CACNA1E)
Ion channels [BR:ecb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100054582 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 100054582
NCBI-ProteinID: XP_023496436
Ensembl: ENSECAG00000012027
VGNC: 15984
LinkDB All DBs
Position
5
AA seq 2456 aa AA seqDB search
MVPEMRGLSPGRRLPEPAPCPTASGSPEPGPAGRLRRHVLALPEEEAWRPQQCALLEADA
SDEVGMLPASPRAAAAGFDNFFPVQEGEGPGWEGSSSPFLPVSPEVMKRRRGGLIEQRDI
IKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAY
KQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATI
IANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNG
WNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMV
PLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYEC
RDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGS
FFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEEN
KNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFR
HKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLF
LLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRI
FKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSAN
FDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFL
AIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMW
EPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNP
LNAHPSLYRRSRPIEGLALGLGLEKCEEERISRGGSLKGDGGDLSSALDNQRSPLSLGKR
EPPWLSRPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPTSTSRS
RSASQERSLDEGVSTEGEKDCEPRGSHGVKEPTIQEEERARDLRRTNSLMVSRGSGLAGA
LDEANTPLVLPQPELEVGKDAALTEQEPEGSSEQALLGDVHLDMGRAISQSEPDLSCSTA
NTDKAATESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEEVEKKQQK
KEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVL
TNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAF
ALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYK
LFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDN
IIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNI
FVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVS
PSFEYTIMAMIALNTIVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNY
FRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILL
WTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLF
RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL
FVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGL
GKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDAELQK
ETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAP
MFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGHSGYPSMSPLSPQEIFQLACMDPADD
GQFQEQQSLEPEVSEFKSVQPSNHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSM
RRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHR
SGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGS
LSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSISPPADGSEGGSPLAS
QALESNDAILTESSNSRHAQQGPHSSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVA
TSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 7371 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccaggccgcaggctgcccgagcccgccccctgc
ccgactgcgagcgggagccctgagccggggcccgcgggccgcctccgccgccacgtcctg
gccctgcccgaggaggaggcatggcggccccagcagtgcgccctgctcgaggccgacgcc
tcggacgaggtgggcatgctgccggcctccccgcgcgccgcggccgccggcttcgacaac
ttcttcccggtgcaggagggcgagggcccgggctgggagggcagctccagccccttcctc
cccgtgagcccagaggtgatgaagcggcggcgcggcggcctcatcgagcagcgcgacatc
atcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccggcgcaaggagtgg
gagatggctcgcttcggggaggcggtggtcggcaggcccgggtcaggcgatggagactcg
gaccagagcaggaaccggcaaggaacccccgtgcctgcctcggggccggcggccgcctac
aagcagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccgg
cagaactgtttcaccgtcaacagatccctcttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggccaccatc
attgccaactgcatcgtcttggccctggagcagcaccttccagaggatgacaagacccca
atgtcccgcagactggagaagacagaaccatatttcattgggatcttttgctttgaagct
ggcatcaaaatcgtggccctggggttcatcttccataagggctcgtacctccgcaatggc
tggaatgtcatggacttcattgtggtcctcagtggcatcctggccaccgcgggaacccac
ttcaatacacacgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaag
ctcgtgtcaggcattcctagcctgcagattgtgttgaagtccatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggc
ttggagttctacagtgggaagttgcaccgagcatgcttcatgaacaattcaggtattcta
gaaggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgc
agggactggattggccccaacgatgggatcacccaatttgataacatcctttttgctgtg
ctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatcc
ttctttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagag
agagtggagaaccggagagctttcatgaaactgcggcgccagcagcagattgagcgcgag
ctgaacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaatgctgggacgtcagccttagaagtgcttcgaagggcaacaatcaaaaggagcaga
acggaggctatgactcgagactccagcgacgagcactgtgtcgatatctcctctgtgggc
acacctcttgcccgagccagcatcaagagtgccaaagtggacggggcctcctatttccgg
cacaaggaaaggcttctgcgcatttctatccgccacatggttaaatcccaggtgttttac
tggattgtgctgagccttgtggctctcaacaccgcctgtgtggccatcgtccatcataac
cagccccagtggctcacccacctcctctactatgcagaatttttgtttctggggctcttc
ctcttggagatgtctctgaagatgtacggcatggggccccgcctttattttcactcttca
ttcaactgctttgattttggggtcacagtgggcagtatcttcgaagtggtctgggcaatc
ttcagacctggtacatcttttggaatcagtgtcttacgagctctccggcttctcagaata
tttaaaataaccaagtactgggcatccctgcggaatttggtggtctccttgatgagttcc
atgaagtcgatcatcagtttgctcttcctcctcttcctcttcattgttgtctttgctctt
ctaggaatgcagctgtttggaggcaggtttaattttaatgatgggactccttcagcaaac
tttgacaccttcccagcagccatcatgactgtattccagatcctgactggtgaggactgg
aatgaggtgatgtacaatgggatccgctcccagggtggagtcagctcaggcatgtggtcg
gctatctacttcattgtgctcaccttgtttggaaactacacgctgctgaacgtgttcttg
gccattgctgttgacaatctggccaatgcccaggagctgaccaaggatgagcaggaagaa
gaggaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtcc
gcacccaacatgccgtctatcgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccgacaccacatgtcggtgtgggag
cagcgcaccagccagctgagaaggcacatgcagatgtccagccaggaggctctcaataaa
gaggaggccccgccaatgaaccccctcaaccctctcaacccactgagccccctcaaccca
ctcaacgcccaccccagcctctaccggagatcaaggcccattgagggcctggccctgggc
ctgggcctggagaagtgcgaggaggaacgcatcagccgtggcggatccctcaagggggac
ggaggggatctctcaagtgccctggacaatcagaggagccccttgtctctgggcaaacgg
gaaccgccgtggctgtccaggccctgtcatgggaactgtgacccgacccagcaggaggct
gggggaggggagaccgtggtgaccttcgaggaccgggccaggcaccggcagagccagcgg
cgcagccggcaccgccgcgtgcggacagaaggcaaggagcccacctcaacctcccggagc
aggtctgccagccaggagcggagtctggatgaaggggtgtctaccgagggggagaaggac
tgtgagcccaggggcagccatggggtcaaggaacccacaatccaggaagaagagcgagcc
cgggatttaaggaggactaacagtctgatggtgtccagaggctctgggctggcaggagcc
ctcgatgaggccaacacacccctagtcctgccccaacccgagctggaagtggggaaggat
gcagcgctgacagagcaggagccggagggcagcagtgagcaagccctgctgggggacgtg
catctggacatgggccgggccatcagccagagtgagcctgacctctcctgctccacagcc
aacacagataaggccgccactgagagcaccagcgtcactgttgccatccctgacgtgggc
cccttggtggactctacagtggtgcacattagcaacaagacggatggagaagccagtccc
ctgaaggaggcggagatcaaagaggaggaggaggaggaggtggagaagaagcagcagaag
aaggagaagcgtgagacgggcaaagccatggtgccccacagctctatgttcatcttcagc
accaccaacccgattcgcagggcctgccactacatcgtgaacctgcgctactttgagatg
tgcattctcctggtcatcgcagccagcagcattgccctggcggccgaggaccctgtcctg
accaactcggagcgcaacaaagtcctgaggtattttgactatgttttcactggcgtgttc
accttcgagatggttataaagatgatagaccagggcttgatcctgcaggatgggtcctac
ttccgagacctgtggaacatcctagactttgtggtggtggttggcgcattggtggccttt
gctttggcgaacgctttgggaaccaacaaggggcgggacatcaagaccatcaagtctttg
cgggtgctccgagttctgaggccactgaagaccatcaagcgcttgcccaagcttaaggct
gtgttcgactgtgtggtgacctccttgaaaaacgtcttcaacatcctcatcgtctacaag
ctcttcatgttcatctttgctgtcatcgcagttcagcttttcaagggaaagttcttttat
tgcacggacagttccaaggacaccgagaaagagtgcataggcaactatgtagatcatgag
aaaaacaagatggaggtcaaaggccgagaatggaagcgccatgagttccactatgacaac
attatctgggccctgctgaccctcttcactgtctccacgggggaaggatggcctcaagtt
ttgcaacattctgttgatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatg
gagatgtccatcttttacgtggtctattttgtagtcttccctttcttctttgtcaatatc
tttgtggctctcattatcatcaccttccaggagcaaggtgacaagatgatggaggagtgc
agcctggagaagaatgagagggcatgtatcgacttcgccatcagtgccaaacccctcacc
cgctacatgccgcagaacaggcacaccttccagtaccgtgtctggcactttgtggtgtcc
ccatcctttgagtacaccatcatggccatgatcgccttgaacaccatcgtgctgatgatg
aagtactactctgctccctgtacctatgaactggccctgaagtacctgaacatcgccttc
accatggtgttttccctggaatgtgtcctaaagatcattgcgtttggcttcttgaactat
ttccgagacacctggaatatctttgacttcatcaccgtgatcggaagcatcacagaaatt
attctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctc
ttccgagccgcccgcctcatcaagcttctgcgtcagggctacaccatccgtattttactt
tggaccttcgtccagtcctttaaggccctgccctacgtctgccttttgattgccatgctt
ttcttcatctacgccatcattgggatgcaggtatttggaaacataaaattagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttgggtcgctcatgttactcttc
aggagtgccacaggtgaggcctggcaggagatcatgctgtcgtgcctcggggagaaaggc
tgtgagccggacaccaccgcaccctcagggcagaacgagaatgagcgttgcggcactgat
cttgcctacgtttactttgtctctttcatcttcttctgctccttcttgatgctcaacctg
tttgtggctgtcatcatggacaactttgagtacctgactcgggattcgtctatcctgggg
cctcaccacttggacgagtttgtccgtgtctgggcagaatatgacagagctgcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtg
gctgaagacatgacagtccacttcacctccacacttatggctctgatccggacagctctg
gatatcaaaattgccaaaggtggtgcagacaggcagcagctagacgcagagctacaaaag
gaaaccctggccatttggcctcacctgtcccagaagatgctggatctgctggtgcccatg
cccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactac
tataaacagagtaaggcgaagaagcaaaggcagcagctggaggaacagaaaaacgcaccc
atgttccagcgcatggagccctcatctctgcctcaggagatcatcgctaatgccaaagcc
ctgccttatctccagcaggaccccgtctcaggcctgagtggccatagtggatacccttcg
atgagtccactctccccccaggaaatattccagttggcttgtatggacccagcagatgac
ggacagttccaggaacagcagtctctggagccagaggttagtgaatttaaaagcgtgcag
ccctctaaccatggcatctaccttccttcggacacccaggagcatgcgggatctgggagg
gcatcctctatgccacgcctgactgtggatccccaggtggtgacagatcccagctccatg
agacgatcattttccactattcgggataagcgttccaattcctcatggttggaggaattc
tccatggaacgaagcagtgaaaacacctacaagtcacgtcgccggagttaccactcctcc
ctcaggctgtcagcccatcgcctgaactctgactcaggccacaagtccgacacccaccgc
tcagggggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgatgtc
tcccgctgcaactcagaggagcgagggacccaggccgactgggagtccccagagcgtcgt
cagtccaggtctcccagtgagggcaggtcacagacccccaacagacagggcacaggctcc
ctgagtgaaagctccatcccctccgtctctgacaccagcaccccaagacggagtcgtcgg
cagctcccaccagtccctcctaagcctcggcccctcctctcctacagctccctgatacga
cacaccgggagcatctcgccacccgctgatgggagtgagggtggctccccactggcctcc
caagctctggagagcaacgacgctatcctgaccgagtcttccaactcccggcacgcacag
cagggcccacactcctccccacagcgctacatctccgagccctacctggccctgcacgaa
gactcccatgcctcggactgtggcgaggaggagacgctcacctttgaagcagctgtggct
accagcctgggccgttccaacaccatcggctcagccccgcccctgcggcacagctggcag
atgcccaatgggcactatcggcggcggaggcgtggggggcctgggccaggcgtgatgtgt
ggagctgtcagcgacctcctgagcgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system