KEGG   Equus caballus (horse): 100054674
Entry
100054674         CDS       T01058                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04071  Sphingolipid signaling pathway
ecb04115  p53 signaling pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04722  Neurotrophin signaling pathway
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05012  Parkinson disease
ecb05014  Amyotrophic lateral sclerosis
ecb05016  Huntington disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05132  Salmonella infection
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100054674 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100054674 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100054674 (BAX)
   04215 Apoptosis - multiple species
    100054674 (BAX)
   04217 Necroptosis
    100054674 (BAX)
   04115 p53 signaling pathway
    100054674 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100054674 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100054674 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054674 (BAX)
   05202 Transcriptional misregulation in cancer
    100054674 (BAX)
   05203 Viral carcinogenesis
    100054674 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100054674 (BAX)
   05212 Pancreatic cancer
    100054674 (BAX)
   05225 Hepatocellular carcinoma
    100054674 (BAX)
   05226 Gastric cancer
    100054674 (BAX)
   05214 Glioma
    100054674 (BAX)
   05216 Thyroid cancer
    100054674 (BAX)
   05220 Chronic myeloid leukemia
    100054674 (BAX)
   05217 Basal cell carcinoma
    100054674 (BAX)
   05218 Melanoma
    100054674 (BAX)
   05213 Endometrial cancer
    100054674 (BAX)
   05224 Breast cancer
    100054674 (BAX)
   05222 Small cell lung cancer
    100054674 (BAX)
   05223 Non-small cell lung cancer
    100054674 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100054674 (BAX)
   05014 Amyotrophic lateral sclerosis
    100054674 (BAX)
   05016 Huntington disease
    100054674 (BAX)
   05020 Prion disease
    100054674 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100054674 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100054674 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100054674 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100054674 (BAX)
   05152 Tuberculosis
    100054674 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100054674 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100054674 (BAX)
   05161 Hepatitis B
    100054674 (BAX)
   05160 Hepatitis C
    100054674 (BAX)
   05164 Influenza A
    100054674 (BAX)
   05162 Measles
    100054674 (BAX)
   05168 Herpes simplex virus 1 infection
    100054674 (BAX)
   05163 Human cytomegalovirus infection
    100054674 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100054674 (BAX)
   05169 Epstein-Barr virus infection
    100054674 (BAX)
   05165 Human papillomavirus infection
    100054674 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100054674 (BAX)
   01524 Platinum drug resistance
    100054674 (BAX)
   01522 Endocrine resistance
    100054674 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100054674 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100054674 (BAX)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100054674 (BAX)
Transporters [BR:ecb02000]
 Other transporters
  Pores ion channels [TC:1]
   100054674 (BAX)
SSDB
Motif
Pfam: Bcl-2 TetR_C_30
Other DBs
NCBI-GeneID: 100054674
NCBI-ProteinID: XP_023505844
VGNC: 50999
LinkDB
Position
10
AA seq 205 aa
MSHLSSLVPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGDTPELGL
EEVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSDFGS
PTWQTVTIFVAGVLTASLTIWKKMG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccacctcagttccctggttcccctaggacccaagagtccaggcacctcttccctc
ctttctcctctagggcccaccagctctgagcagatcatgaagacaggggcccttttgctt
cagggtttcatccaggatcgcgcggggcggatggggggagacacacccgagctgggcctg
gaggaggtgccccaggatgcgtccaccaagaagctgagcgagtgtctcaagcgcatcgga
gatgagctggacagtaacatggagctgcagaggatgattgcggccgtggacacggactcc
ccccgcgaggtctttttccgagtggcagctgagatgttttccgacggcaacttcaactgg
ggccgggttgttgcccttttctactttgccagcaaattggtgctcaaggccctgtgcacc
aaggtgcccgagctgatcaggaccatcatgggctggacactggacttccttcgagagcgg
ctgctgggctggatccaggaccagggtggttgggacggcctcctctccgactttgggtca
cccacgtggcagacagtgaccatcttcgtggccggagtgctcaccgcctcgctcaccatc
tggaagaagatgggctga

DBGET integrated database retrieval system