KEGG   Equus caballus (horse): 100054723Help
Entry
100054723         CDS       T01058                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04910  Insulin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04931  Insulin resistance
Module
ecb_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100054723 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100054723 (GYS1)
   04152 AMPK signaling pathway
    100054723 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100054723 (GYS1)
   04922 Glucagon signaling pathway
    100054723 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100054723 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecb01003]
    100054723 (GYS1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100054723 (GYS1)
Glycosyltransferases [BR:ecb01003]
 Polysaccharide
  Storage polysaccharide
   100054723 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100054723
NCBI-ProteinID: NP_001119597
Ensembl: ENSECAG00000021428
VGNC: 18670
UniProt: B2L109
LinkDB All DBs
Position
10
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLDDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCTHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPREADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDVPPDEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRGSVDTGPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggacgattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctacagacgaaggcgaaggtgacaggggatgaatggggcgac
aactactacctggtgggaccatacacggagcaaggcgtgaggacccaggtggagctgctc
gagcccccaaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggccccctggtggtgctcctggatgtgggg
gcctcagcctgggccctggaacgctggaagggagagctttgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcacacttccac
gagtggttggcgggcatcgggctctgcctgtgccgtgcccggcggctgcctgtggctaca
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggtgctgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagctggtgagaggcaaatttatcac
cgttactgcatggagcgggcggcagcccactgcactcacgtcttcactaccgtgtcccag
atcaccgccattgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggcccgaatccaggagtttgtgcgtggccatttttatgggcacctggacttcaacttg
gataagaccctgtatttctttatcgccggccgctacgagttctccaacaagggggctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtaaatggcagcgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctc
aaggggcaagccgtgcgcaagcagctctgggatacggcgaacacagtgaaggagaagttc
gggaggaagctttacgaatccctgctggttgggagcctcccggacatgaacaagatgctg
gacaaggaggatttcactatgatgaagagagccatctttgccacgcagcggcagtctttt
ccccctgtgtgcacccacaatatgctggacgactcctcggaccctatcctgaccaccatc
cgtcgaatcggcctcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggactatgaggagtttgtccgtggctgc
caccttggggttttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gttatgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagcttacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacat
ttcacctacgagccccgcgaggctgatgcgacccagggctaccgctacccacggcctgca
tcggtgcctccgtcgccctcactgtcacgacactcgagcccgcaccagagcgaggacgag
gaggagccccgggacgtgccgcccgatgaagacagtgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgccccggagtggccgcgtcgcgcctcctgcacc
tcttccacgagcgggagcaagcgcggctcggtggacacggggccctccagctcgctcagc
acccccagcgagcccctcagccccgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system