KEGG   Equus caballus (horse): 100054739
Entry
100054739         CDS       T01058                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04530  Tight junction
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05215  Prostate cancer
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100054739 (ERBB2)
   04012 ErbB signaling pathway
    100054739 (ERBB2)
   04066 HIF-1 signaling pathway
    100054739 (ERBB2)
   04020 Calcium signaling pathway
    100054739 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100054739 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100054739 (ERBB2)
   04520 Adherens junction
    100054739 (ERBB2)
   04530 Tight junction
    100054739 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054739 (ERBB2)
   05206 MicroRNAs in cancer
    100054739 (ERBB2)
   05205 Proteoglycans in cancer
    100054739 (ERBB2)
   05230 Central carbon metabolism in cancer
    100054739 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100054739 (ERBB2)
   05226 Gastric cancer
    100054739 (ERBB2)
   05219 Bladder cancer
    100054739 (ERBB2)
   05215 Prostate cancer
    100054739 (ERBB2)
   05213 Endometrial cancer
    100054739 (ERBB2)
   05224 Breast cancer
    100054739 (ERBB2)
   05223 Non-small cell lung cancer
    100054739 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100054739 (ERBB2)
   01524 Platinum drug resistance
    100054739 (ERBB2)
   01522 Endocrine resistance
    100054739 (ERBB2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100054739 (ERBB2)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100054739 (ERBB2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100054739 (ERBB2)
CD molecules [BR:ecb04090]
 Proteins
  100054739 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CBP_BcsF
Other DBs
NCBI-GeneID: 100054739
NCBI-ProteinID: XP_001501155
Ensembl: ENSECAG00000020409
VGNC: 17649
UniProt: A0A3Q2H4E6
LinkDB
Position
11
AA seq 1255 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPASASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DLLDNATSATGAVPGGLRELQLRSLTEILKGGVLIQRNPQLCHQDTILWEDIFHKNNQLT
LTLIDTNRSRACQPCSPACRPSHCWGESSEDCQNLTRTVCAGGCARCKGPRPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPSLVIYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQDFAGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLQELGSGLALVHHNARLCFVHTV
PWAQLFRNPHQALLHSANRPEDECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACTHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGTCQPCPINCTHSCLDLDDRGCPAEQRASPVTSIIAAVVG
ILLVVVIGLVLGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGTAHRRHRSSSSRSGGGELTLGLEPSEEEPPKSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLPQHDPSPLQRYSEDPTVPLPPETDGYVAPLSCSPQPEYV
NQPEVRPQPPSPLEGPLSPCRPDGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
SRAAPQPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctgccagccagtcctgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gagctcacctacctgccagccagcgccagcctctccttcctgcaggatatccaggaggtg
caaggctatgtgctcatcgctcacaaccaagtgagacaggtcccactgcagaggctgcga
atcgtgcgaggcacccagctctttgaggacaactacgccctggctgtgctggacaatgga
gacctgctggacaatgccacctctgctacaggggctgtcccaggagggctgcgggagcta
cagcttcgaagcctcacagagatcttgaagggaggggtcttgatccagcggaacccccag
ctctgccaccaggacacgattttgtgggaggacatcttccacaagaacaaccagctgacc
ctcacgctgatagacaccaaccgctcacgggcctgccaaccctgttctccagcttgtaga
ccctcccactgctggggagaaagttccgaggactgtcagaacttgacgagaactgtctgt
gccggtggctgtgcccgctgcaagggcccgcggcccaccgactgctgccatgagcagtgt
gctgccggctgcacaggccccaagcactccgactgcctggcctgcctccacttcaaccac
agcggcatctgtgagctgcactgcccatccctggtcatctacaacacggacaccttcgag
tccatgcccaaccctgagggccggtataccttcggcgccagctgtgtgaccgcctgtcct
tacaactacctgtctacggacgtgggatcctgcaccctggtctgtcccctgaacaaccaa
gaggtgacagctgaggacggaacacagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggcctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggactttgctggctgcaagaagatctttgggagcctggcatttctgccggagagc
tttgagggggacccagcctccaacactgcccccctacagcctgagcagctcagagtgttt
gagaccctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgcct
gacctcagtgtcttccagaacctgcgagtaatccggggccgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatcagctggttggggctgcgctcgctgcaggaa
ctgggcagcgggctggcccttgtccaccacaatgcccgcctctgcttcgtccacacggtg
ccctgggcccagctcttccggaacccccaccaggccctgcttcacagtgccaaccgccca
gaggacgagtgtgtgggcgagggcctggcctgctacccgctgtgcgcccacgggcactgc
tggggtccgggccccacccagtgtgtcaactgcagccagttccttcggggccaggaatgc
gtggaggaatgccgagtactgcaggggctcccccgggaatatgtgaaggacaggtactgt
ctgccgtgccaccccgaatgtcagccccagaatggctcagtgacttgctttggatcggag
gctgaccagtgtgtggcctgcacgcactacaaggacccgcccttctgcgtggctcgctgc
cccagcggtgtgaaacctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcacgtgccagccgtgccccatcaactgcacccactcctgtttggacctggatgacagg
ggctgtcccgccgaacagagagccagccctgtgacatccatcattgctgctgtggtgggc
attttgctggtggtggtcattggtctggtcctcggcatcctaatcaagcgaaggcggcag
aagatccggaaatacacgatgcggaggctgctgcaggaaacggagctggtggagccgctg
acacctagcggagcgatgcccaaccaggctcagatgcgaatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcacagtctacaagggcatctggatc
cctgatggagaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtgggctctcca
tatgtgtcccgcctcttgggcatctgcctgacatccacagtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgagaacaccgcggccgcctgggctcccag
gacctgctgaactggtgtgtgcagattgctaaggggatgagctacttggaggatgtgcgg
cttgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
attacagacttcgggctggctcggctgctggacattgacgagacagagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagctcgggagatccctgacctgctggagaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgattatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggccctgccagccccttg
gacagcactttctaccgctcgctgctggaggatgatgacatgggggacctggtagatgct
gaggagtacctggtaccccagcagggcttcttctgcccggaccctgctcctggtgctggg
ggcacagcccaccgcaggcaccgcagctcatcctccaggagtggcggtggtgagctgacg
ctggggctggagccctcggaggaggagccccccaagtctccactggcaccttcagaaggg
gctggctctgatgtgtttgatggtgacttgggaatgggggcagccaaggggctgcagagc
ctcccacaacatgaccccagccctctacagaggtacagcgaggaccccacagtacccctg
cccccggagactgacggctatgttgcccccctgtcctgcagcccccagcctgaatacgtg
aaccagccagaggttcggccgcagcccccctcgcccctagagggccctctgtctccttgt
cgacctgatggtgccactttggaaaggcccaagactctctcccccgggaagaatggggtt
gtcaaagacgtttttgcctttgggggtgccgtggagaaccctgagtacttggcaccccgg
agcagagctgcccctcagccccaccctcctcctgccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggctctccacccagcacctttgaagggacc
cctacagcagagaacccggaatacctgggcctggacgtgccagtgtga

DBGET integrated database retrieval system