KEGG   Equus caballus (horse): 100054807Help
Entry
100054807         CDS       T01058                                 

Gene name
MICAL3
Definition
(RefSeq) F-actin-monooxygenase MICAL3 isoform X1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100054807 (MICAL3)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     100054807 (MICAL3)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100054807 (MICAL3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100054807 (MICAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM FAD_binding_3 Pyr_redox_3 Pyr_redox_2 FAD_binding_2 NAD_binding_7 DAO NAD_binding_8 HI0933_like Pyr_redox Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 100054807
NCBI-ProteinID: XP_023498590
LinkDB All DBs
Position
6
AA seq 2259 aa AA seqDB search
MEESKKEMVNRAHLLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACANTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQQLREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMENLVNSRTTPKLIRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLSSRDALALNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEVPRGYRGGRPTLVSTLTDRRMDVALGNQN
KVKYMATQLLAKFEENAPPQSTGMRRQPTQERGVSQPSCCLPEQGRPASIPQWKQRREKE
RSRTCPKKVITLSPPPTPPPCRARGSQQTYRDLGADSRGKQSPHHERPEPEPSRRFFVDQ
WELSLSLRSSNRPASPSSDSLRQKYIKMYTGGVSSLAEQIANQLQRKEQPKTLLDKKELG
SVKKEFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFQCEHCAATLRLSAYAYDAA
AGKFYCKPHYCYRLSGSAQRKRPALAPLSGKEARGPLQDGPTADANGRANAITSPAARTP
GSGVNGLEEPSIAKRLRGTPERIELENYRLSVKQAEELEEVPEETQAEHNLSSVLDKGAE
EDVASSSSESEMEEEDEEEDEEEEQPPLPTSDLGGVPWKEAVRIHALLKGKSEEELEASK
SYEPGNEEDEEEEEDEEEEEEEEYDEEEEESSEEGEYCPWDRELRQGQWLQHLSEEEDTG
TCKAGSHRLQQIMNPADPLEIQADVHWTHIHEKEEEERMVPTSESSTSRVPGLPSIRRAA
VQAWLETVSRVPFDENDLEEDVDSEPAEIEGEAAENGDTGDTGAELDDDQHWSDDVPSDA
DTELRLQHQAAVEAELELRVSENEEEPPPATPRRQERGPSQVSSPTRSPEEQPVLFSPVH
SPETEGAQSPLTSAAANGKSPGEHLFPEPLLLTAKPRAEAPTDQKVVPSPIRSQPVALPE
ARTPTSPVSSQHLSSLAASTPPTQLPICSQPQPSSEATVPSPTKSPIRFQPVPAKTSTPL
TPIPMKNQGDAKDSLGSPLAVDEVLKRNDLVAEFWMKSAEIRRSLGLTPVHRSKGLEPSF
PSPAFKPVSPKSYSVEKSPQGEGLHLLKPPPIPKRLGLPKSDGDQPSLPTPKSPSDRQLK
SSHEEQRDLSSSSGLGLQESSSNMKTLGSQSFNTSDSTMLTPPSSPPPPPPPDEEPATLQ
GKPYQGYEHKEAGPKASVIPPLPPATFMRPPRESARPPQEELRKSFVESVEEIPFADDVE
DTYDDKTEDSSLQEKFFTPPSCWSCSEKPLQPPLAKENGRLPTQESGVQPQKRGLPLVSP
EAKELAEERMRAREKSVKSQALRDAMAKQLSRMKEMEMAAGTSRPPGGTARRAASVLSKG
KEVGPESPKCPVLKGPEESTLKHEATSEGVLSPPSDSGGPDGSVTSSEGSSGKSKKRSSL
FSPRRNKKEKKSKGAGRPPEKPSPSLLEEAATKPKSLWKSVFSGYKKDKKKKGEDKSCSS
TPSSRTTVDSGKHRMSPLMRAGLQLGRQLSFSEDSDLSSDDILERSSQKSRRESIYVPHA
LAFRRSYASKPRTYTEEELNAKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLEQVEEKQ
RQLEERGVAVEKALRGEAVEPSGGTPRRRPLSFCPCCVQEGMGKKDDPKLMQEWFKLVQE
KNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEEELSEEKKILNEMLDV
VEQRDALVALLEEQRLREKEEDKDLEAVMLSKGFSLNWS
NT seq 6780 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagcaagaaggagatggtgaatcgagctcacctcctctttgaccggtttgtg
caggccaccacctgcaaggggaccctcaaggccttccaagagctctgtgaccacctggag
ctgaagccgaaggactaccgctccttttatcacaaactcaagtccaagcttaactactgg
aaagccaaagccctctgggcaaagctggacaaacggggcagccacaaggactacaaaaag
gggaaagcatgcgccaacaccaagtgtctcatcattggagctggcccctgtggtctccgc
acagctattgacttatccttattgggagctaaggtggtcgttattgagaaacgagatgcc
ttctcccgcaacaatgtcttgcatctctggccattcaccatacatgatctgcgaggtctg
ggtgccaagaagttctatggcaagttctgtgctggagccattgaccatatcagtatccgt
cagcttcaactaatacttttgaaagtagccttgatcctaggcattgaaatccatgtcaat
gtggaattccaaggacttgtacagcctcctgaggaccaagaaaatgaacggataggttgg
cgggcactagtgcaccccaaaactcatcctgtatcggagtacgaatttgaagtgatcatc
ggaggggatggccggaggaacaccttggaaggatttcgtcgcaaagaatttcgtggcaaa
ctggccattgccattacagcaaattttattaacagaaatacaacagcagaagccaaagtg
gaagagatcagtggtgtggcttttattttcaaccaaaaatttttccagcaactgagggaa
gccacaggtatcgacttggagaacatcgtctactataaagatgacacgcactatttcgtt
atgacagccaaaaagcagagtttactggacaaaggggtgatactgcatgactacgccgac
acagagctcttgctttcccgggaaaatgtggaccaagaggctctgctgagctatgccagg
gaggcagcagacttttccacccagcagcagctgccatctctggattttgccatcaatcac
tatgggcagcccgacgtggccatgtttgacttcacttgtatgtatgcctccgagaacgcc
gccttggtgcgtgagcagaatggacaccaattattagtggctctggttggggacagcctc
ctggagcctttttggccaatgggaacaggaatagcccggggctttttagctgctatggac
tctgcctggatggtacgaagttggtctctaggaacaagccccctggaagtcctagcagag
agggagagtatttataggttgctgccccagaccacccctgagaatgtgagtaaaaacttc
agccaatacagcatagaccctgtcaccagatatcccaatattaacgtcaacttcctccgg
ccaagccaggtgcgccatttatatgatactggagaaacaaaagatattcatctggaaatg
gagaacctggtgaattcccgaactaccccaaagttgatacgcaatgagtctgtagctcgt
tcaagcaaactgctgggttggtgccagaggcagaccgatggctacgcaggggtgaatgtg
acagacctcaccatgtcttggaaaagtggcctggccctgtgtgcgattatccacagatac
cgccccgatctgatagattttgattctttggatgagcaaaatgtggagaagaataaccaa
ctggcctttgatattgctgagaaggaactgggcatttctcccatcatgacaggcaaagaa
atggcctcggtgggggagcccgacaagctgtccatggtgatgtacctgactcagttctac
gagatgttcaaggactcgctctcctccagggacgccttggccctgaatgctgaggagaag
gcagtcctgatagccagcaccaagtctcccatctccttcctaagcaaactcgggcagacc
atctctcggaagcgttctcccaaggataaaaaggaaaaggacttggatggtgctggaaag
aggagaaagactagtcaatcagaagaggaggaggtaccccggggctaccgaggaggaagg
cccacgctggtgagcactctgacggacaggaggatggacgtggccctcggtaaccagaac
aaagtgaagtacatggcaacccagctgctggccaaatttgaagagaacgcaccgccacag
tccactggcatgaggagacagccgacacaggagcgtggggtcagccagccatcctgctgc
ctgcctgagcagggtcgccctgcttccatcccccagtggaaacagcgacgggaaaaggag
cgttctcggacctgtcccaaaaaagtgatcacactttctcctccccctactccacctccc
tgtcgggcgcgtggcagccagcagacttacagggatcttggtgctgacagccgtggcaag
cagagtccccaccatgagaggccagagcctgaaccttctcgtcgattttttgttgaccag
tgggagctttctcttagtctccgctcttccaaccgccccgcctctccctcctctgactcc
ctccgacagaagtatataaagatgtacacgggcggagtgagctcattggctgagcagata
gccaatcagcttcaaaggaaagaacagcccaaaacccttctagacaagaaggaactgggc
tccgtgaagaaggagttcccgcagaacctgggaggcagcgacacgtgctatttttgccag
aagcgagtctacgtgatggagaggctgagcgccgagggcaagttcttccaccggagctgc
ttccagtgcgagcactgcgccgccacgctgcgcctgtcggcctacgcctacgacgccgcg
gccggtaaattctactgcaaaccgcactactgttaccgactctccggctccgcccagagg
aagagaccagcactggctcctctgtctggaaaggaggccagaggacccctgcaggatggc
cccactgcagacgcaaatggacgggccaacgccatcaccagccctgctgcgagaactcca
ggttcaggtgtgaatggcctggaggagcccagcattgccaagaggctgaggggtactccc
gaaaggattgagctggagaactaccgcctgtctgtgaaacaggcagaggagctggaggag
gtgcccgaggagacgcaggccgagcacaacctgagcagcgtgctggacaagggcgcagag
gaggacgtggccagcagcagttctgagtctgaaatggaggaggaggacgaggaggaggac
gaggaggaggagcagcctccgctgcccacctcggacctgggcggtgttccttggaaggag
gctgtgaggatccatgctcttctgaaagggaagagtgaagaggaactggaggcctcgaag
agctacgagcctgggaatgaagaggacgaggaggaggaggaggacgaggaggaggaggag
gaggaggagtatgacgaggaggaggaagagtctagtgaagaaggggagtattgcccctgg
gacagagaactccggcaaggccagtggctccagcatctgtcagaagaagaagacacgggt
acatgtaaagccgggagccacaggctacagcagatcatgaatccagccgatcccttggag
atccaggctgatgtgcactggacgcatattcatgagaaagaggaggaagagcgaatggtg
ccgacctctgagtcctctacttctagagtgcctggccttccctccatacgccgcgcagca
gtgcaggcctggctggagacggtctcccgagttccatttgatgagaatgacctggaggaa
gatgtggactcggagccggcagagatagaaggggaggcagcagagaatggggacacaggg
gacactggtgctgagctggatgatgatcagcactggtctgatgacgtcccctcagatgcc
gacacggagctgcgcctgcagcaccaggcagcagtggaggcggagctggagttgagggta
tcagaaaatgaggaggagccaccaccggccacaccaaggcgccaagagagaggtccttcc
caagtctccagccccactcggtcccctgaggaacagcctgtcctcttctccccagtgcac
agccctgagacagagggggcccaaagcccactcacctctgccgctgccaacgggaaatcg
cccggagagcaccttttccccgagcctttgctcctcacagcaaagcccagagcagaagca
cccactgatcagaaagtggtgccctctcccatccgctcacagccagtggctctgccggaa
gccaggacacctacctccccagttagctcgcagcacctgtcatcgttggccgcctccacc
ccccccacccagctccccatttgctcccagcctcagccttcctctgaggccactgtccca
tccccaaccaagtcccccatacgcttccagcctgttccagccaaaacatcgacccccctg
acccccatccccatgaagaaccaaggggatgccaaggacagcctgggtagccctcttgct
gtggacgaggtcctgaaacggaatgacctagtggcagagttctggatgaagagcgccgaa
atccgccgcagccttgggctaacacccgtacatcggagcaaagggctggagcccagcttc
ccctcacctgcctttaagccagtgtccccaaagtcctattcagttgagaagtctccgcag
ggtgaggggctccatcttctaaaaccaccacctattcccaagaggctgggcctgccaaag
tcagatggtgaccagccctccctgccgacccccaagtccccctctgacagacagctgaag
agctcccacgaggagcagagagacctgtccagcagctccgggctgggccttcaagaaagc
tcctccaacatgaagactctgggcagccagagcttcaacacctcggactccaccatgctc
actccgccttccagcccgcccccccctccgcctccggacgaggagcccgccactcttcaa
gggaagccgtatcaggggtacgagcataaggaagctgggcccaaggcctcagtgatccca
cctctgccacctgctacctttatgcgtcccccccgggagtctgcccggcccccccaggag
gagttgcggaagtcatttgtagagagtgtggaggagatcccctttgccgatgatgtggaa
gacacgtatgatgacaagactgaagactcaagtctgcaggagaaattcttcacacccccc
tcctgctggtcctgctctgagaagcccctccagccacccctagccaaggagaatggtagg
ttgcctactcaggagagtggggtccagccacagaagagggggctgcccttagtctctcca
gaagccaaggagctggctgaggagcgcatgcgagccagggagaagtctgtcaagagccag
gcattgagagatgccatggccaagcagctgagtaggatgaaggagatggagatggcagct
gggacctccaggccccccggtggcaccgcccgcagagccgcctctgtgctctccaagggc
aaagaagtcggcccagagtctcctaagtgcccagtgctaaaaggccccgaggagtccacc
ctgaagcatgaagccactagtgagggggtcctctctcctccatcggactcagggggccca
gatggttcagtcacctcatctgagggctccagtgggaagagcaagaagagatcgtcactc
ttctcccctcgcagaaacaagaaagagaagaagtccaaaggagcgggccggcccccggag
aagcccagcccaagcctcctagaggaagcagccaccaagcccaagtccttgtggaagtca
gtcttctctgggtacaagaaggacaagaagaagaagggtgaggacaagtcctgctccagc
accccttccagcaggaccactgtggactcgggcaagcacaggatgtctcctctcatgagg
gcagggctgcagctcgggcgccagctgagtttctcggaggactctgacctctccagtgac
gacatcctggagaggtcctcccagaagtctaggcgagagtcgatttatgtgccacacgcc
ttggcattcaggagatcatatgcatcaaagccaagaacctacacagaggaggagctgaat
gccaagctgacccgccgcgtgcagaaggcagctcggagacaggccaagcaagaggaactg
aagcggctgcaccgagcccagatcatccagcggcagctggagcaggtggaggagaagcag
aggcagctggaggagagaggggtcgctgtggagaaggcgctccgcggtgaggcagttgag
cccagtggcgggactccacggcgtagacctctctccttctgcccttgctgtgtccaggaa
ggaatgggcaagaaggatgaccccaagctgatgcaggagtggttcaagctggtgcaagag
aagaatgccatggtgcgctacgagtcggagctgatgattttcgcccgggagctggaactg
gaagaccggcagagccgcctgcagcaggagctccgggagcggatggcagtggaagatcac
ctgaagactgaggaggagttgtcagaggagaagaagatcctgaatgagatgctggacgta
gtggagcagagagatgccctcgtggccctgctagaggagcagcggctccgggaaaaagag
gaggacaaggacctggaggccgtcatgctgtcaaagggcttcagcctgaactggtcctga

DBGET integrated database retrieval system