KEGG   Equus caballus (horse): 100054961
Entry
100054961         CDS       T01058                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04728  Dopaminergic synapse
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100054961 (AKT3)
   04012 ErbB signaling pathway
    100054961 (AKT3)
   04014 Ras signaling pathway
    100054961 (AKT3)
   04015 Rap1 signaling pathway
    100054961 (AKT3)
   04370 VEGF signaling pathway
    100054961 (AKT3)
   04371 Apelin signaling pathway
    100054961 (AKT3)
   04630 JAK-STAT signaling pathway
    100054961 (AKT3)
   04668 TNF signaling pathway
    100054961 (AKT3)
   04066 HIF-1 signaling pathway
    100054961 (AKT3)
   04068 FoxO signaling pathway
    100054961 (AKT3)
   04072 Phospholipase D signaling pathway
    100054961 (AKT3)
   04071 Sphingolipid signaling pathway
    100054961 (AKT3)
   04024 cAMP signaling pathway
    100054961 (AKT3)
   04022 cGMP-PKG signaling pathway
    100054961 (AKT3)
   04151 PI3K-Akt signaling pathway
    100054961 (AKT3)
   04152 AMPK signaling pathway
    100054961 (AKT3)
   04150 mTOR signaling pathway
    100054961 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100054961 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100054961 (AKT3)
   04218 Cellular senescence
    100054961 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100054961 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100054961 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100054961 (AKT3)
   04613 Neutrophil extracellular trap formation
    100054961 (AKT3)
   04620 Toll-like receptor signaling pathway
    100054961 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100054961 (AKT3)
   04660 T cell receptor signaling pathway
    100054961 (AKT3)
   04662 B cell receptor signaling pathway
    100054961 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100054961 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100054961 (AKT3)
   04062 Chemokine signaling pathway
    100054961 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100054961 (AKT3)
   04922 Glucagon signaling pathway
    100054961 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100054961 (AKT3)
   04920 Adipocytokine signaling pathway
    100054961 (AKT3)
   04929 GnRH secretion
    100054961 (AKT3)
   04915 Estrogen signaling pathway
    100054961 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100054961 (AKT3)
   04917 Prolactin signaling pathway
    100054961 (AKT3)
   04926 Relaxin signaling pathway
    100054961 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100054961 (AKT3)
   04919 Thyroid hormone signaling pathway
    100054961 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100054961 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100054961 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100054961 (AKT3)
   04728 Dopaminergic synapse
    100054961 (AKT3)
   04722 Neurotrophin signaling pathway
    100054961 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100054961 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100054961 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100054961 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054961 (AKT3)
   05205 Proteoglycans in cancer
    100054961 (AKT3)
   05230 Central carbon metabolism in cancer
    100054961 (AKT3)
   05231 Choline metabolism in cancer
    100054961 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100054961 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100054961 (AKT3)
   05212 Pancreatic cancer
    100054961 (AKT3)
   05225 Hepatocellular carcinoma
    100054961 (AKT3)
   05226 Gastric cancer
    100054961 (AKT3)
   05214 Glioma
    100054961 (AKT3)
   05221 Acute myeloid leukemia
    100054961 (AKT3)
   05220 Chronic myeloid leukemia
    100054961 (AKT3)
   05218 Melanoma
    100054961 (AKT3)
   05211 Renal cell carcinoma
    100054961 (AKT3)
   05215 Prostate cancer
    100054961 (AKT3)
   05213 Endometrial cancer
    100054961 (AKT3)
   05224 Breast cancer
    100054961 (AKT3)
   05222 Small cell lung cancer
    100054961 (AKT3)
   05223 Non-small cell lung cancer
    100054961 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100054961 (AKT3)
   05017 Spinocerebellar ataxia
    100054961 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100054961 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100054961 (AKT3)
   04931 Insulin resistance
    100054961 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100054961 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100054961 (AKT3)
   05135 Yersinia infection
    100054961 (AKT3)
   05152 Tuberculosis
    100054961 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100054961 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100054961 (AKT3)
   05161 Hepatitis B
    100054961 (AKT3)
   05160 Hepatitis C
    100054961 (AKT3)
   05164 Influenza A
    100054961 (AKT3)
   05162 Measles
    100054961 (AKT3)
   05168 Herpes simplex virus 1 infection
    100054961 (AKT3)
   05163 Human cytomegalovirus infection
    100054961 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100054961 (AKT3)
   05169 Epstein-Barr virus infection
    100054961 (AKT3)
   05165 Human papillomavirus infection
    100054961 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100054961 (AKT3)
   05142 Chagas disease
    100054961 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100054961 (AKT3)
   01524 Platinum drug resistance
    100054961 (AKT3)
   01522 Endocrine resistance
    100054961 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100054961 (AKT3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100054961 (AKT3)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100054961 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 100054961
NCBI-ProteinID: XP_023488546
Ensembl: ENSECAG00000019722
VGNC: 15220
LinkDB
Position
30
AA seq 495 aa
MDAWLELKVRSCCLPSTLGVSLCCDGSLEKTGEYIKNWRPRYFLLKTDGSFIGYKEKPQD
VDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQA
VADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVIL
VREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFV
MEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGH
IKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRL
PFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSF
FSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNER
RPHFPQFSYSASGRE
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggatgcgtggctggaactcaaagtgagaagttgctgtctccccagcaccttgggtgtc
agtctttgctgcgatggctctcttgagaagacaggagaatatataaaaaactggaggcca
agatacttccttttgaagacagatggctcgttcatagggtataaggagaaacctcaagat
gtggacctaccttatcctctcaacaacttctcagtggcaaaatgccagttaatgaaaaca
gaacgaccaaagccaaacacatttattatcagatgtctccagtggaccactgtcatagag
agaacctttcacgtagacactccagaagaaagggaagaatggacagaagctatccaggct
gtagcagacagacttcagaggcaagaagaggagagaatgaattgtagtccaacttcacag
atagataatataggggaggaagagatggatgcttccacaacccatcataaaaggaagaca
atgaatgactttgactatttgaaactactaggtaaaggcacttttgggaaagttattttg
gttcgagagaaggcaagtgggaaatattatgctatgaagattctgaagaaagaagttatt
attgcaaaggatgaagtggcacacactctaactgaaagcagagtattaaagaacactaga
catccctttttaacatccttgaaatattccttccagacaaaagaccgtttgtgttttgtg
atggaatatgttaatgggggagagctgtttttccatttgtcgagagagcgggtgttctct
gaggaccgcacgcgtttctatggtgcagaaatcgtctctgccttggactatctgcactcc
gggaagattgtgtaccgtgatctcaagttggagaatttgatgctggataaagacgggcac
ataaaaattacagattttggactttgcaaagaagggatcacagatgccgccaccatgaag
acgttctgtggaacaccagaatacctggcaccagaggtgttagaagataatgactatggc
cgagccgtggactggtggggcctaggggttgtcatgtatgaaatgatgtgtgggaggttg
cctttctacaaccaggatcatgagaaactttttgaactaatactaatggaagacattaaa
tttcctcgaacactctcttcagatgcaaaatcattgctttcagggctcttgataaaggat
ccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatgagacacagtttc
ttttctggagtaaactggcaagatgtatatgataaaaagcttgtacctccgtttaagcct
caagtaacatctgagacagataccagatattttgatgaagaatttacggctcagactatt
acaataacaccacctgaaaaatatgacgaggacggcatggactgcatggacaacgagcgg
cggccgcacttcccgcagttttcctactccgcaagtggacgggaataa

KEGG   Equus caballus (horse): 100061130
Entry
100061130         CDS       T01058                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04728  Dopaminergic synapse
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100061130 (AKT1)
   04012 ErbB signaling pathway
    100061130 (AKT1)
   04014 Ras signaling pathway
    100061130 (AKT1)
   04015 Rap1 signaling pathway
    100061130 (AKT1)
   04370 VEGF signaling pathway
    100061130 (AKT1)
   04371 Apelin signaling pathway
    100061130 (AKT1)
   04630 JAK-STAT signaling pathway
    100061130 (AKT1)
   04668 TNF signaling pathway
    100061130 (AKT1)
   04066 HIF-1 signaling pathway
    100061130 (AKT1)
   04068 FoxO signaling pathway
    100061130 (AKT1)
   04072 Phospholipase D signaling pathway
    100061130 (AKT1)
   04071 Sphingolipid signaling pathway
    100061130 (AKT1)
   04024 cAMP signaling pathway
    100061130 (AKT1)
   04022 cGMP-PKG signaling pathway
    100061130 (AKT1)
   04151 PI3K-Akt signaling pathway
    100061130 (AKT1)
   04152 AMPK signaling pathway
    100061130 (AKT1)
   04150 mTOR signaling pathway
    100061130 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100061130 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100061130 (AKT1)
   04218 Cellular senescence
    100061130 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100061130 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100061130 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100061130 (AKT1)
   04613 Neutrophil extracellular trap formation
    100061130 (AKT1)
   04620 Toll-like receptor signaling pathway
    100061130 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100061130 (AKT1)
   04660 T cell receptor signaling pathway
    100061130 (AKT1)
   04662 B cell receptor signaling pathway
    100061130 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100061130 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100061130 (AKT1)
   04062 Chemokine signaling pathway
    100061130 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100061130 (AKT1)
   04922 Glucagon signaling pathway
    100061130 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100061130 (AKT1)
   04920 Adipocytokine signaling pathway
    100061130 (AKT1)
   04929 GnRH secretion
    100061130 (AKT1)
   04915 Estrogen signaling pathway
    100061130 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100061130 (AKT1)
   04917 Prolactin signaling pathway
    100061130 (AKT1)
   04926 Relaxin signaling pathway
    100061130 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100061130 (AKT1)
   04919 Thyroid hormone signaling pathway
    100061130 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100061130 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100061130 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100061130 (AKT1)
   04728 Dopaminergic synapse
    100061130 (AKT1)
   04722 Neurotrophin signaling pathway
    100061130 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100061130 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100061130 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100061130 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061130 (AKT1)
   05205 Proteoglycans in cancer
    100061130 (AKT1)
   05230 Central carbon metabolism in cancer
    100061130 (AKT1)
   05231 Choline metabolism in cancer
    100061130 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100061130 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100061130 (AKT1)
   05212 Pancreatic cancer
    100061130 (AKT1)
   05225 Hepatocellular carcinoma
    100061130 (AKT1)
   05226 Gastric cancer
    100061130 (AKT1)
   05214 Glioma
    100061130 (AKT1)
   05221 Acute myeloid leukemia
    100061130 (AKT1)
   05220 Chronic myeloid leukemia
    100061130 (AKT1)
   05218 Melanoma
    100061130 (AKT1)
   05211 Renal cell carcinoma
    100061130 (AKT1)
   05215 Prostate cancer
    100061130 (AKT1)
   05213 Endometrial cancer
    100061130 (AKT1)
   05224 Breast cancer
    100061130 (AKT1)
   05222 Small cell lung cancer
    100061130 (AKT1)
   05223 Non-small cell lung cancer
    100061130 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100061130 (AKT1)
   05017 Spinocerebellar ataxia
    100061130 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100061130 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100061130 (AKT1)
   04931 Insulin resistance
    100061130 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100061130 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100061130 (AKT1)
   05135 Yersinia infection
    100061130 (AKT1)
   05152 Tuberculosis
    100061130 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100061130 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100061130 (AKT1)
   05161 Hepatitis B
    100061130 (AKT1)
   05160 Hepatitis C
    100061130 (AKT1)
   05164 Influenza A
    100061130 (AKT1)
   05162 Measles
    100061130 (AKT1)
   05168 Herpes simplex virus 1 infection
    100061130 (AKT1)
   05163 Human cytomegalovirus infection
    100061130 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100061130 (AKT1)
   05169 Epstein-Barr virus infection
    100061130 (AKT1)
   05165 Human papillomavirus infection
    100061130 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100061130 (AKT1)
   05142 Chagas disease
    100061130 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100061130 (AKT1)
   01524 Platinum drug resistance
    100061130 (AKT1)
   01522 Endocrine resistance
    100061130 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100061130 (AKT1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100061130 (AKT1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100061130 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100061130
NCBI-ProteinID: XP_023484336
Ensembl: ENSECAG00000008264
VGNC: 15217
LinkDB
Position
24
AA seq 508 aa
MESCAGRAPGSCSRIFWHAHRLPSQACGCHPPGCPQPTDRPAGPGEYIKTWRPRYFLLKN
DGTFIGYKERPQDVEQRESPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVE
TPEEREEWTTAIQTVADGLKRQEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEY
LKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTA
LKYSFQTHDRLCFVMEYANGGELFFHLSRERVFPEDRARFYGAEIVSALDYLHSEKNVVY
RDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDW
WGLGVVMYEMVCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRL
GGGSEDAKEIMQHRFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPP
DQDDTMEGVDSERRPHFPQFSYSASGTA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggagagctgtgctggcagagcccccgggtcctgctctcggatcttctggcatgcgcac
cgtctacccagccaggcttgtggttgtcatcctcctgggtgtccccaacccacggacagg
ccagctggaccaggagagtacatcaagacctggcggccccggtacttcctcctcaagaac
gacggcaccttcatcggctacaaggagcggccgcaggacgtggagcagcgcgagtcgccc
ctcaacaacttctcggtggcacagtgccagctgatgaagacggagcggcccaggcccaac
accttcatcatccgctgcctgcagtggaccacggtgatcgagcgcaccttccacgtggag
acgcccgaggagcgggaggagtggacgactgccatccagacagtggctgatgggctcaag
aggcaggaggaagagatggacttccgatcgggctcacccagtgacaactctggggccgag
gagatggaggtgtccctggccaagcccaaacaccgtgtgaccatgaacgagtttgagtac
ctgaagctcctgggcaaaggcacctttgggaaggtgattctggtgaaggagaaggccacg
ggccgctactacgccatgaagatcctgaagaaggaagtcatcgtggccaaggacgaggtg
gcccacacgctcacggagaaccgcgtgctccagaactcccggcatcccttcctgacggct
ctcaagtactccttccagacccatgaccgcctgtgcttcgtcatggagtacgccaacggg
ggcgagctcttcttccacctgtcccgggagcgcgtgttccccgaggaccgggcccgcttt
tacggcgccgagatcgtgtcggccctggactacctgcactctgagaagaatgtcgtctac
cgtgacctcaagctggagaacctcatgctggacaaggacgggcacatcaagatcactgac
tttgggctgtgcaaggagggcatcaaggatggggccaccatgaagaccttctgcgggaca
cctgagtacctggcccccgaggtgctggaggacaacgactacggccgggcggtggactgg
tgggggctgggcgtggtcatgtacgagatggtgtgcggccgcctgcccttctacaaccag
gaccacgagaagctcttcgagctcatcctcatggaggagatccgcttcccgcgcacgctc
agccctgaggccaagtccctgctctcggggctgctcaagaaggaccccaagcagaggctg
ggcgggggctccgaggacgccaaggagatcatgcagcaccgcttctttgccagcatcgtg
tggcaggacgtgtatgagaagaagctcagcccgcccttcaagccccaggtcacatcggag
acagacaccaggtattttgatgaggagttcacggcccagatgatcaccatcacgccgccc
gaccaagacgacacgatggagggtgtggacagcgagcggaggccccacttcccccagttc
tcctactcggccagcggcacggcctga

KEGG   Equus caballus (horse): 100064671
Entry
100064671         CDS       T01058                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04725  Cholinergic synapse
ecb04728  Dopaminergic synapse
ecb04910  Insulin signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04922  Glucagon signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04926  Relaxin signaling pathway
ecb04929  GnRH secretion
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb04973  Carbohydrate digestion and absorption
ecb05010  Alzheimer disease
ecb05017  Spinocerebellar ataxia
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100064671 (AKT2)
   04012 ErbB signaling pathway
    100064671 (AKT2)
   04014 Ras signaling pathway
    100064671 (AKT2)
   04015 Rap1 signaling pathway
    100064671 (AKT2)
   04370 VEGF signaling pathway
    100064671 (AKT2)
   04371 Apelin signaling pathway
    100064671 (AKT2)
   04630 JAK-STAT signaling pathway
    100064671 (AKT2)
   04668 TNF signaling pathway
    100064671 (AKT2)
   04066 HIF-1 signaling pathway
    100064671 (AKT2)
   04068 FoxO signaling pathway
    100064671 (AKT2)
   04072 Phospholipase D signaling pathway
    100064671 (AKT2)
   04071 Sphingolipid signaling pathway
    100064671 (AKT2)
   04024 cAMP signaling pathway
    100064671 (AKT2)
   04022 cGMP-PKG signaling pathway
    100064671 (AKT2)
   04151 PI3K-Akt signaling pathway
    100064671 (AKT2)
   04152 AMPK signaling pathway
    100064671 (AKT2)
   04150 mTOR signaling pathway
    100064671 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100064671 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100064671 (AKT2)
   04218 Cellular senescence
    100064671 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100064671 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100064671 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100064671 (AKT2)
   04613 Neutrophil extracellular trap formation
    100064671 (AKT2)
   04620 Toll-like receptor signaling pathway
    100064671 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100064671 (AKT2)
   04660 T cell receptor signaling pathway
    100064671 (AKT2)
   04662 B cell receptor signaling pathway
    100064671 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100064671 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100064671 (AKT2)
   04062 Chemokine signaling pathway
    100064671 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100064671 (AKT2)
   04922 Glucagon signaling pathway
    100064671 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100064671 (AKT2)
   04920 Adipocytokine signaling pathway
    100064671 (AKT2)
   04929 GnRH secretion
    100064671 (AKT2)
   04915 Estrogen signaling pathway
    100064671 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100064671 (AKT2)
   04917 Prolactin signaling pathway
    100064671 (AKT2)
   04926 Relaxin signaling pathway
    100064671 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100064671 (AKT2)
   04919 Thyroid hormone signaling pathway
    100064671 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100064671 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100064671 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100064671 (AKT2)
   04728 Dopaminergic synapse
    100064671 (AKT2)
   04722 Neurotrophin signaling pathway
    100064671 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100064671 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100064671 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100064671 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064671 (AKT2)
   05205 Proteoglycans in cancer
    100064671 (AKT2)
   05230 Central carbon metabolism in cancer
    100064671 (AKT2)
   05231 Choline metabolism in cancer
    100064671 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100064671 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100064671 (AKT2)
   05212 Pancreatic cancer
    100064671 (AKT2)
   05225 Hepatocellular carcinoma
    100064671 (AKT2)
   05226 Gastric cancer
    100064671 (AKT2)
   05214 Glioma
    100064671 (AKT2)
   05221 Acute myeloid leukemia
    100064671 (AKT2)
   05220 Chronic myeloid leukemia
    100064671 (AKT2)
   05218 Melanoma
    100064671 (AKT2)
   05211 Renal cell carcinoma
    100064671 (AKT2)
   05215 Prostate cancer
    100064671 (AKT2)
   05213 Endometrial cancer
    100064671 (AKT2)
   05224 Breast cancer
    100064671 (AKT2)
   05222 Small cell lung cancer
    100064671 (AKT2)
   05223 Non-small cell lung cancer
    100064671 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100064671 (AKT2)
   05017 Spinocerebellar ataxia
    100064671 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100064671 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100064671 (AKT2)
   04931 Insulin resistance
    100064671 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100064671 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100064671 (AKT2)
   05135 Yersinia infection
    100064671 (AKT2)
   05152 Tuberculosis
    100064671 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100064671 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100064671 (AKT2)
   05161 Hepatitis B
    100064671 (AKT2)
   05160 Hepatitis C
    100064671 (AKT2)
   05164 Influenza A
    100064671 (AKT2)
   05162 Measles
    100064671 (AKT2)
   05168 Herpes simplex virus 1 infection
    100064671 (AKT2)
   05163 Human cytomegalovirus infection
    100064671 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100064671 (AKT2)
   05169 Epstein-Barr virus infection
    100064671 (AKT2)
   05165 Human papillomavirus infection
    100064671 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100064671 (AKT2)
   05142 Chagas disease
    100064671 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100064671 (AKT2)
   01524 Platinum drug resistance
    100064671 (AKT2)
   01522 Endocrine resistance
    100064671 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100064671 (AKT2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100064671 (AKT2)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100064671 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100064671
NCBI-ProteinID: XP_005596303
Ensembl: ENSECAG00000008005
VGNC: 15219
UniProt: A0A5F5PYR8
LinkDB
Position
10
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDLDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagtgacggctccttcattggctacaaggag
cggcccgaggcgcccgaccagaccctgccccccctaaacaacttctctgtcgcagagtgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccacgtagactctccggacgagagggaagagtggatg
cgggccatccagatggtcgccaacagcctgaagcagcggggccccggggaggaccccatg
gactacaagtgtggctcccccagcgactcttcggcggccgaggagatggaggtggcggtt
agcaaggcgcgggccaaggtgaccatgaacgacttcgactatctcaaactcctgggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagattctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgagtcctccagaacaccaggcacccgttcctcaccgccctgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggtgagctgttcttccac
ttgtcccgggagcgcgtcttcacggaggagcgggcccgcttctatggcgcagagatcgtc
tcggccctggagtacctgcactctcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaggagggc
atcagtgatggggccaccatgaagaccttctgtgggacccctgaatacctggctcccgag
gtgctggaggacaatgactacggccgggctgtggactggtgggggctgggcgtggtgatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtacagaag
aagctcctgccacccttcaaacctcaggtcacatccgaggtcgacacgaggtacttcgac
gacgagttcactgcccagtccatcaccatcacccccccggaccgctatgacagcctgggc
tcgctcgacctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

DBGET integrated database retrieval system