KEGG   Equus caballus (horse): 100054982
Entry
100054982         CDS       T01058                                 

Gene name
CUL2
Definition
(RefSeq) cullin-2
  KO
K03870  cullin 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100054982 (CUL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100054982 (CUL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054982 (CUL2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100054982 (CUL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100054982 (CUL2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     100054982 (CUL2)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N
Other DBs
NCBI-GeneID: 100054982
NCBI-ProteinID: NP_001288145
Ensembl: ENSECAG00000015528
VGNC: 16967
UniProt: A0A3Q2L9D5
LinkDB
Position
29
AA seq 745 aa
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDSLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQTILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLNPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQSHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgtctttgaaaccaagagtagtagattttgatgaaacatggaacaaacttttaacgaca
atcaaagctgttgtcatgttggaatacgttgaaagagcaacatggaacgatcgcttctca
gatatctatgctttatgtgtggcctatcctgaaccccttggagaaagactttatacagaa
actaagatttttttggaaaatcacgtacggcatttgcacaagagagtcctggagtctgaa
gagcaagtacttgtcatgtatcataggtactgggaggagtatagcaagggagcagattac
atggacagcttgtataggtatctcaacacccagttcattaagaagaataagttgacagaa
gctgaccttcagtatggctacggcggtgtggatatgaatgagccactgatggaaatagga
gagctagctttggatatgtggaggaaattgatggttgagccacttcagaccatccttatc
agaatgctgctccgagagattaaaaatgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcaggaaatctttgagtctccctttctgactgaaacaggagagtattacaaa
caagaagcttcaaatttattacaagaatcaaactgttcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattcgatgtcgaaaatacttgaacccaagttcatatact
aaagtgattcatgaatgtcaacaacgaatggtggcagaccacttacagttcttacatgca
gaatgccacaatatcatccgacaagagaagaaaaacgacatggcaaacatgtatgtctta
ctgcgcgctgtgtccactggtttacctcatatgattcaggagctgcaaagccatatccac
gacgagggccttcgagccaccagtaatcttactcaggaaaatatgccaacactatttgtg
gaatcagttttggaagtacatggcaagtttgttcaacttatcaacactgttctgaatggt
gatcagcactttatgagtgcgttggataaggcccttacgtcagttgtaaactacagagaa
cccaagtcggtttgcaaagcacctgaattgcttgctaagtactgtgacaacttactaaag
aaatcggcgaaggggatgactgagaatgaagtagaagacaagctcacaagcttcattact
gtcttcaagtatatcgatgataaggatgtttttcaaaagttctacgcaaggatgctggca
aaacgtttaattcacgggttgtctatgtctatggattctgaagaagctatgatcaataaa
ttaaagcaagcttgtggctatgagtttaccagcaagctacatcggatgtatacagatatg
agtgtcagtgctgatctcaataataagttcaacaattttatcaaaaatcaagacacagta
atagatttgggaattagttttcaaatatatgttctgcaggctggagcgtggcctcttact
caggctccttcatctacatttgctattccccaggagttggaaaaaagtgtacagatgttt
gaattattttacagtcagcatttcagtgggaggaaacttacatggttacattacctctgt
acaggagaagttaaaatgaactatctgggcaaaccatatgtagccatggttacaacatac
caaatggcagttcttcttgcctttaacaacagtgagactgtcagctataaagagcttcaa
gacagcactcagatgaatgagaaggaactgacgaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagacatcgatgcggaatcttcattttcatta
aatatgaacttcagcagtaaaagaacaaaatttaagattactacgtcaatgcagaaagac
acaccacaggaaatggaacagactagaagtgctgtagatgaggaccggaaaatgtatctg
caagctgctatagttcgtatcatgaaagcacggaaagtacttcggcataacgccctcatt
caagaggtgattagccagtcaagagctaggtttaatcctagcatcagcatgattaagaag
tgtattgaagttctcatagacaaacagtacattgaacgcagccaagcgtcagcagatgaa
tacagctacgtagcgtga

DBGET integrated database retrieval system