KEGG   Equus caballus (horse): 100055024
Entry
100055024         CDS       T01058                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04514  Cell adhesion molecules
ecb04530  Tight junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04810  Regulation of actin cytoskeleton
ecb05100  Bacterial invasion of epithelial cells
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05145  Toxoplasmosis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100055024 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100055024 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100055024 (ITGB1)
   04514 Cell adhesion molecules
    100055024 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100055024 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100055024 (ITGB1)
   04530 Tight junction
    100055024 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100055024 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055024 (ITGB1)
   04670 Leukocyte transendothelial migration
    100055024 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100055024 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055024 (ITGB1)
   05205 Proteoglycans in cancer
    100055024 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100055024 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100055024 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100055024 (ITGB1)
   05414 Dilated cardiomyopathy
    100055024 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100055024 (ITGB1)
   05133 Pertussis
    100055024 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100055024 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100055024 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100055024 (ITGB1)
   05140 Leishmaniasis
    100055024 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100055024 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100055024 (ITGB1)
   04515 Cell adhesion molecules [BR:ecb04515]
    100055024 (ITGB1)
   04090 CD molecules [BR:ecb04090]
    100055024 (ITGB1)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100055024 (ITGB1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100055024 (ITGB1)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin beta subunits
   100055024 (ITGB1)
CD molecules [BR:ecb04090]
 Proteins
  100055024 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100055024
NCBI-ProteinID: NP_001288146
Ensembl: ENSECAG00000022498
VGNC: 19175
UniProt: A0A3Q2IDL5
LinkDB
Position
29
AA seq 808 aa
MANREFQMNLQLVFWIGLISSICYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTF
LQEGMPTSARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQ
IQPQQLVLQLRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEM
RRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFN
ELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGI
VLPNDGQCHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIP
KSAVGTLSANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGR
KCSNISIGDEVQFEISITSNKCPNKNSETIKIKPLGFTEEVEVVLQFICECECQSEGVPS
SPRCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVC
GQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCS
LDTTSCMATNGQICNGRGICECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFN
KGEKKDTCAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEA
IVHVVETPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNA
KWDTQENPIYKSPINNFKNPNYGRKAGL
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggctaacagggagtttcagatgaatttacaactggttttctggattggactgatcagt
tcaatttgttatgtgtttggccaagcagatgaaaatagatgtttaaaagcaaatgccaaa
tcatgtggagaatgtatacaagcagggccaaattgtggatggtgcacaaactcgacattt
ttacaagaagggatgcctacctctgcacgatgtgatgatttagaagccttaaaaaagaag
ggttgccatccagatgacatagaaaatcccagaggctccaaagatataaagaaaaataaa
aatgtaaccaaccggagcaaagggacggcagagaagctccagccagaagacatcacccag
atccagccccagcagttggttttgcagttacgatcaggggagccacaaacatttgcatta
aaattcaagagagctgaagactatcccattgatctctactaccttatggacctttcttac
tctatgaaagatgatttggagaatgtaaaaagtcttggaaccgatctgatgaatgaaatg
aggaggattacttcagacttccgaattgggtttggctcatttgtggagaaaactgtgatg
ccttacattagtacaacaccagccaagctcagaaacccttgcacaagtgaacagaactgc
accagcccatttagctacaaaaatgtgctcagtcttactgataaaggggaagtatttaat
gagctggttggtaaacagcgcatatctggaaatttggattctccagaaggtggctttgat
gcaatcatgcaagttgcagtttgtggatcattgattggctggaggaatgttactcggctg
ctggtattttccacggatgctgggtttcactttgctggagatgggaaacttggtggcatt
gttttaccaaatgatggacagtgtcacttggaaaatgatgtgtacacaatgagccattat
tatgattatccttctattgctcaccttgtccagaaactaagtgaaaataacatacagacg
atttttgcagttactgaagaatttcagcctgtttacaaggaactgaaaaatttgatccct
aagtcagcagtaggaacattatctgctaattccagcaatgtaattcagttgatcattgat
gcatacaattccctttcctcagaagtcattttggaaaacagtaaattgccagaaggagta
acaataaattacaaatcttactgcaagaatggggtaaatggaacaggggaaaatggaagg
aaatgctccaatatttccattggagatgaggttcagtttgaaatcagcataacttcaaat
aaatgtccaaataagaattctgaaaccattaaaatcaagcctctgggcttcactgaagag
gtggaggttgtgcttcagttcatctgtgagtgtgagtgccagagcgagggcgtccccagc
agcccccggtgtcacgagggcaacggcacgttcgagtgtggggcctgcaggtgcaacgag
gggcgtgttggcagacactgtgaatgtagcacagacgaagtgaacagtgaggatatggat
gcttactgccggaaggaaaacagttcagaaatctgcagtaacaatggagagtgtgtctgt
ggacagtgtgtttgtaggaagagggataatacaaatgaaatttattctggcaaattctgc
gagtgtgataatttcaactgtgatagatccaatggcttaatttgcggaggaaatggtgtt
tgcaagtgtcgtgtgtgcgaatgcaaccccaactacactggcagtgcgtgtgactgttct
ctggacactacttcatgcatggccaccaatggccagatctgcaatggccggggcatctgt
gagtgtggggcctgcaagtgcacagatcccaagtttcaggggccaacctgtgagatgtgt
cagacgtgccttggtgtctgtgctgagcataaagaatgtgttcagtgcagagcctttaat
aaaggagaaaagaaagacacatgcgcccaggaatgttcacatttcaacattaccaaggtt
gaaaatcgggacaagttacctcagccaggccaggttgatcccctgtctcactgtaaggag
aaggatgtggatgactgctggttctatttcacgtattcagtgaatgggaacaatgaggcc
attgttcacgttgtggagactccagagtgccccactggtccagacatcattccaattgta
gctggtgtggttgctggaattgttcttattggccttgcattgctgctgatttggaagctt
ttaatgataattcatgacagaagggaatttgccaaatttgagaaggaaaaaatgaatgcc
aaatgggacacgcaagaaaatccgatttacaagagtcctattaataatttcaagaatcca
aactatggacgtaaagctggtctctaa

DBGET integrated database retrieval system