KEGG   Equus caballus (horse): 100055123Help
Entry
100055123         CDS       T01058                                 

Gene name
HPX
Definition
(RefSeq) hemopexin
  KO
K18977  hemopexin
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100055123 (HPX)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100055123 (HPX)
Transporters [BR:ecb02000]
 Other transporters
  Pores ion channels [TC:1]
   100055123 (HPX)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   100055123 (HPX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hemopexin
Motif
Other DBs
NCBI-GeneID: 100055123
NCBI-ProteinID: XP_005612174
Ensembl: ENSECAG00000016475
VGNC: 18866
UniProt: F6X1I8
LinkDB All DBs
Position
7
AA seq 462 aa AA seqDB search
MAPVLGGPVALGLLGLCWSLAIANPLPPDSAPGTGAEGGNGVKQDPDVIERCSDGWSSDA
TTLDEHGAMVFFKGEFMWKSPNWTRELISERWKNFIGPADAAFRRSNDSVFLIKGDKVWV
YPPGKKEKGYPKLLQEEFPGIPSPLDAAVECHRGECQDEGILFFKGNRTWFWDLATRTTK
ERFWLAVQNCSSAMRWLNRYYCFSGNKFLRFNPVSGEVPPKYPLDVRDYFMPCPGRGHRN
RTGHGTGTHRGYGASRCSPDLALSALVSDNHGATYAFSESHHWRLDTSKDGWHSWPIDHQ
WPKGPSTVDAAFSWDDKLYLIQGTQVYIFLTKGGHTLVDGYPKRLEKELGSPHGISLETV
DAAFMCPGSSRLHVMAGRRLWWLDLKSGAAATWTELPWPHEKVDGALCVEKSLGPHSCSA
NGLGLYLIQGPNLYCYSDVEKLNAAKALPKPQRMNSLLGCHN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctccagtgctgggaggaccagttgcgctggggttgttgggcctgtgctggtctctg
gccattgccaaccctcttcctccggatagtgcacctgggaccggagctgaaggtgggaat
ggggtcaagcaggacccagacgtgatcgaacgctgctcagatggctggagctctgatgct
accaccctggatgaacatggggccatggtgtttttcaaaggggagttcatgtggaagagt
cccaactggacccgcgaattaatctcagagaggtggaagaatttcattggccctgcggat
gctgcattccgccgtagtaatgacagcgtctttctgatcaagggggacaaagtctgggtg
taccctcctgggaagaaggagaaaggatatccaaagttgctccaagaggagtttcctgga
atcccatccccactggatgcagctgtggaatgtcaccgtggagaatgccaagatgagggc
atcctcttcttcaaaggtaaccgcacctggttctgggacttggctacgagaaccacaaag
gagcgtttctggcttgctgttcagaattgctcctctgccatgcgatggctcaaccgctac
tactgcttctcgggtaacaagttcctgcgtttcaaccccgtctcaggagaggtacctccc
aagtaccctctggatgtccgagactacttcatgccctgccctggcagaggccacagaaac
aggactggccacgggactggtacccaccgtggctatggggcttcgcgatgtagcccagat
ctagccttgtctgcattggtgtctgacaaccatggtgccacctacgccttcagtgagtct
caccactggcgcctggacaccagcaaggatgggtggcatagctggcccattgaccatcag
tggcccaagggtccttcaacagtggatgctgccttttcctgggatgataaactctatctg
atccagggcactcaggtatatatcttcctgacgaagggaggccataccctagtagatggt
tatccaaagcggctggagaaggaactcgggagccctcatgggatcagccttgagactgtg
gacgcagcctttatgtgtcctgggtcttctcggctccacgttatggcaggacggcggctg
tggtggctggacctgaagtcaggagctgcagccacgtggacagagcttccttggccccac
gagaaggttgacggggccctgtgtgtggaaaagtccctcggccctcactcatgttctgcc
aacggtctcggcttgtacctcatccaaggccccaatttgtactgctacagtgatgtggag
aaactgaatgcagccaaagcccttcccaagccccagagaatgaacagcctcctgggctgc
cataattga

DBGET integrated database retrieval system