KEGG   Equus caballus (horse): 100055447
Entry
100055447         CDS       T01058                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04140  Autophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04722  Neurotrophin signaling pathway
ecb04910  Insulin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb05010  Alzheimer disease
ecb05014  Amyotrophic lateral sclerosis
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05165  Human papillomavirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100055447 (BAD)
   04014 Ras signaling pathway
    100055447 (BAD)
   04370 VEGF signaling pathway
    100055447 (BAD)
   04024 cAMP signaling pathway
    100055447 (BAD)
   04022 cGMP-PKG signaling pathway
    100055447 (BAD)
   04151 PI3K-Akt signaling pathway
    100055447 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100055447 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100055447 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100055447 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100055447 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100055447 (BAD)
   04919 Thyroid hormone signaling pathway
    100055447 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100055447 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055447 (BAD)
   05203 Viral carcinogenesis
    100055447 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100055447 (BAD)
   05212 Pancreatic cancer
    100055447 (BAD)
   05225 Hepatocellular carcinoma
    100055447 (BAD)
   05221 Acute myeloid leukemia
    100055447 (BAD)
   05220 Chronic myeloid leukemia
    100055447 (BAD)
   05218 Melanoma
    100055447 (BAD)
   05211 Renal cell carcinoma
    100055447 (BAD)
   05215 Prostate cancer
    100055447 (BAD)
   05213 Endometrial cancer
    100055447 (BAD)
   05223 Non-small cell lung cancer
    100055447 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100055447 (BAD)
   05014 Amyotrophic lateral sclerosis
    100055447 (BAD)
   05020 Prion disease
    100055447 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100055447 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100055447 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055447 (BAD)
   05161 Hepatitis B
    100055447 (BAD)
   05160 Hepatitis C
    100055447 (BAD)
   05162 Measles
    100055447 (BAD)
   05168 Herpes simplex virus 1 infection
    100055447 (BAD)
   05165 Human papillomavirus infection
    100055447 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100055447 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100055447 (BAD)
   01524 Platinum drug resistance
    100055447 (BAD)
   01522 Endocrine resistance
    100055447 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100055447
NCBI-ProteinID: XP_001916789
VGNC: 15752
UniProt: F7DN67
LinkDB
Position
12
AA seq 167 aa
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSH
HGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDE
FQVSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGRGGSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagccagaagactccagccctgcagatagg
ggcctgggccccagccctacgggggactggccctcagacccggtcaggcaccagcggaca
gccccaggcctcctgggggaagctggtcaccagcaggggcagccggccagcagcagccac
catggaggcgctggggcggtggagacccggagtcgccatagctcgtaccccgaggggacc
gaggatgaagggatggaaggggaggagcccggccccttccggggccgctcgcgctcggcg
ccccccaacctctgggctgcacgacgctacggccgcgagctccggaggatgagcgacgag
ttccaggtctccttccaggcacttcctcgcccgaagagcgcgggcacagcgacgcagatg
cggcaaagccccagctggacgcgcgccatccagtcctggtgggatcggaacttggggaga
ggaggctccgccccctcccagtga

DBGET integrated database retrieval system