KEGG   Equus caballus (horse): 100055626
Entry
100055626         CDS       T01058                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X2
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04024  cAMP signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04310  Wnt signaling pathway
ecb04330  Notch signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04520  Adherens junction
ecb04630  JAK-STAT signaling pathway
ecb04720  Long-term potentiation
ecb04916  Melanogenesis
ecb04919  Thyroid hormone signaling pathway
ecb04922  Glucagon signaling pathway
ecb04935  Growth hormone synthesis, secretion and action
ecb05016  Huntington disease
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100055626 (EP300)
   04330 Notch signaling pathway
    100055626 (EP300)
   04350 TGF-beta signaling pathway
    100055626 (EP300)
   04630 JAK-STAT signaling pathway
    100055626 (EP300)
   04066 HIF-1 signaling pathway
    100055626 (EP300)
   04068 FoxO signaling pathway
    100055626 (EP300)
   04024 cAMP signaling pathway
    100055626 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100055626 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100055626 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100055626 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100055626 (EP300)
   04919 Thyroid hormone signaling pathway
    100055626 (EP300)
   04916 Melanogenesis
    100055626 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100055626 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055626 (EP300)
   05206 MicroRNAs in cancer
    100055626 (EP300)
   05203 Viral carcinogenesis
    100055626 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100055626 (EP300)
   05215 Prostate cancer
    100055626 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100055626 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100055626 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100055626 (EP300)
   05161 Hepatitis B
    100055626 (EP300)
   05164 Influenza A
    100055626 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100055626 (EP300)
   05165 Human papillomavirus infection
    100055626 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100055626 (EP300)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100055626 (EP300)
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100055626 (EP300)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100055626 (EP300)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100055626 (EP300)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100055626 (EP300)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100055626 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100055626
NCBI-ProteinID: XP_001502391
Ensembl: ENSECAG00000009327
VGNC: 17605
LinkDB
Position
28
AA seq 2420 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELITSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSGTGMMNSPVNQPAMGMNTGMNAGMNPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTESLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIQTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQAMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTGSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVTSLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQPQFSTQGMNVAN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPLGPQSQALHPPPRQTPTPPPTQLPPQVQP
SLPAASSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEAKMEVDQPEPADTQPEDIPETKAEDCKVEPTETEERGTEL
KTETKEEEAQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAMTDRIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPQPPSQPQPTPPNSMPPYLPRTQAAGPVPQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPS
GHLEPGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNP
QALPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGIQRASLPQQQPQQQLQPP
MGGMSPQAQQMNMNHNTMPSQFRDILRRQQMVVPQQQQQGAGPGIGPGMANHNQFQQPQG
VGYPPQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPA
QPNPMSPQQHMLPNQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQ
PSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLG
LSTDNSDLNPNLSQSTLDIH
NT seq 7263 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattgatcacctctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggtatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctccggtctggtagttcccctaacctcaatatgggagttggtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcctgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgccgtccggaacgggtatgatgaacagtcccgtaaat
caacctgcgatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgact
gcaggcaatggacaggggatgatgcctaatcaagtcatgaatggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
actgagtcactgcagcaaggctctccccagatgggaggacaaacaggattgagaggcccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttctccatacactcag
aactctggacagcagattggagccagtggccttggtctccagattcagacaaagtctgta
ttaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggccaacagcaggccccgcaggtccagcagccaggccttgtgactccagta
gcccaagcgatgggttctggagcacacacagctgatccagagaagcgtaagctcatccag
cagcagcttgttctccttttgcatgctcacaagtgccagcgccgggagcaggctaatggg
gaagtgaggcagtgcaaccttccccattgtcgcacaatgaagaacgtcttaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtcttccccttaaaaat
gctggggataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actggctctctaggtgtgggtcaacagtctacccccagcctaagcactgttagtcagatt
gatcccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcag
atgccgacgcagccccaggtgcaggcaaagaaccagcaaaatcagcagtccgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcaaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtgacctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaaacaatggcatgaagacattactcaggacctt
cgaaatcatcttgttcacaaactcgttcaagccatatttcctactcccgatcctgctgct
ttaaaagacagacggatggaaaacctagtggcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatattaccatctgctagctgagaagatttacaag
atccagaaagaattagaagaaaaacgaaggactagactacagaaacagaatatgctaccg
aatgctgcaggcatggtgccagtttctatgaatccagggcctaacatggggcagccacaa
ccaggaatgacttctaatggccctctacctgatccgtctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacaacctggtttgaatcaatttggccagatgagt
atgccccagccccctattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcaacctggaactctgaacccacctatgggctacggacctcgcatgcagcagccttcc
agccagagccaattccttccccagcctcagttctcaacacagggaatgaatgtagcaaat
atgcctttggctccatctggcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgccctgtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
ccccctctccctcaaccagctctgcatcagaattcaccttctcccgtacccagtcgaacc
cccacccctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
cctgcccctgttcctacacctccagccatgccacttgggcctcagtcccaggctctacat
ccgcctccaaggcagacacctacaccgccaccgacgcaacttcctccccaagtgcagcct
tcacttcctgctgcttcttcagctgaccagccgcagcagcagcctctctcacagcagagt
acagcagcctctgttcccaccccaacggcgccactgctgcctccgcagcctgcaactcca
ctttcccagccagctgtaagcatcgaagggcaggtatcaaaccctccatctactagtagc
acagaagtgaattctcagaccattcctgagaagcagccttcacaggaagtgaaaatggag
gctaagatggaagtggatcaaccagaaccagcagatactcaaccagaggatattccagag
actaaagcagaagactgtaaagtggaacctacagaaacagaagagagaggcactgaatta
aaaactgaaacaaaagaggaggaagcccagccaagtacttcagctacccagtcatctcca
gccccaggacagtcgaagaagaagattttcaaaccagaagagttacgacaggcactgatg
ccaacattggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gaccctcagcttctgggaatccctgattactttgatattgtgaagagccccatggatctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtacgtggac
gacatttggcttatgttcaacaacgcctggttatataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtcttcgaacaagagattgacccagtcatgcaaagc
cttggatattgttgtggcagaaagttggaattctctccacagacactctgttgctatggc
aaacagttatgtacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactg
gatcctgaactgtttgttgaatgtacagaatgtggaagaaagatgcatcagatctgtgtg
cttcatcatgagatcatctggccatctggatttgtctgtgatggctgtttaaagaaaact
gcacgaactaggaaagaaaataagttttctgctaaaaggttgccatccacaaggcttggc
acctttctggagaatcgtgtgaatgactttctgaggcgacaaaatcaccctgagtcagga
gaggtcactgttcgggtagttcacgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatccttcccatatcgaaccaaagcc
ctctttgcctttgaagagatcgatggtgttgacttgtgcttctttggcatgcatgttcaa
gagtatggctctgactgccctccacccaaccagaggagagtatatatatcatacctcgat
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattttaatt
ggatatttagaatacgtcaagaaattaggatatacgacagggcatatttgggcatgtccc
ccaagtgagggagacgactatatcttccattgccatcctcctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgcttgacaaggccatgactgatcgaatt
gtccatgattacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaag
gaattgccttactttgagggtgatttctggcccaatgttctggaagagagcattaaggaa
ctggaacaggaagaggaagagagaaagcgagaggaaaacaccagcaatgaaagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaac
aagagcagccttagtaggggcaacaagaagaagccaggcatgcctaatgtgtccaatgac
ctctcgcagaagctgtacgccaccatggagaaacataaagaggtcttctttgtgatccgt
ctcatcgctggccctgctgccaactccctgcctcccattgtggatcctgaccccctcatc
ccctgtgatctgatggatgggcgggatgcctttctcaccctcgcaagggacaagcacctg
gagttctcttcactccgaagagcccagtggtcaactatgtgcatgctggtggagctccac
acccagagccaggaccgcttcgtctatacctgcaatgagtgcaagcaccacgtggagacc
cgctggcactgcaccgtgtgtgaggattacgatttgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctcggcttagatgatgagagcaacaaccag
caggctgcggccacccagagcccaggagactcacgccgcctcagcatccagcgctgcatc
cagtctctggtccatgcctgccagtgccgaaatgccaattgctccctgccctcctgccag
aagatgaagcgagttgtgcagcataccaagggttgcaaacggaaaaccaatggagggtgc
cccatctgcaagcagctcattgccctctgttgctaccatgccaagcactgccaggagaac
aagtgccctgtgccgttctgcctaaacatcaagcaaaagctccggcagcagcagctgcag
caccggctacagcaggcccagatgctccgcaggaggatggccagcatgcagcggactggt
gtggtggggcagcaacagggcctgccctccccaactcctgccactccaaccacgccaact
ggccaacagcccaccaccccacagacaccccagccccagcccccctctcagccccagccc
acccctcccaacagcatgccaccctacttgcccaggactcaagctgctggccctgtcccc
cagggtaaggcggcaggccaggtgacccctccaactcctcctcagactgctcagccaccc
cttccagggcccccacctgcagcagtggaaatggcaatgcagattcagagggcagcagag
actcagcgccagatggcccatgtgcaaatatttcaaaggccaatccagcaccagatgcca
cagatgactccaatggcccccatgggtatgaacccaccccccatggccagaggtcccagt
gggcatttggagccagggatggggcccacagggatgcagcaacagccaccgtgggcccaa
ggaggattgcctcagccccagcaactacagtccgggatgccaaggccagccatgatgtca
gtggcccagcatggtcagcccttgaacatggctccccaaccaggattgggccaggtaggt
gtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaac
ccccagctgttggctgcattcatcaagcagcgggctgccaagtatgccaactctaatccg
caagccctccctgggcaacctggcatgccccagggccagccagggctgcagccacctacc
atgccaggtcagcagggggtccactccaatccagccatgcagaacatgaatcccatgcag
gcaggcattcagcgggctagcctgccccagcagcaaccacagcagcagctccagccaccc
atgggagggatgagcccccaagctcagcagatgaacatgaatcacaacaccatgccttca
cagttccgagacatcttgagacgacagcagatggtggtgccgcagcagcagcagcaggga
gcagggccaggaatcggccctggaatggccaaccataaccagttccagcaaccccaagga
gttggctaccccccacagcaacagcagcagcagcagcggatgcagcatcacatgcaacag
atgcaacaagggaacatgggacaaatgggccagctcccccaggccttgggagcagaggca
ggagccagtctgcaggcctatcagcagcgcctccttcagcaacagatggggtcccctgct
cagcccaaccccatgagcccccaacagcatatgctcccaaaccaggcccagtccccacac
ctacaaggccagcagatcccgtctctctccaatcaagtgcgttctccccagcctgtccct
tctccacggccacagtcccagccccctcactccagcccttccccaaggatgcagcctcag
ccttctccacaccacgtttccccacagaccagttctccacatcctggactggtagctgcc
caggccaaccccatggaacaagggcattttgccagcccggaccagaattcgatgctttct
cagctcgctagcaatccaggcatggcaaacctccatggtgcaagcgccacggacctggga
ctcagcaccgataactcagacttgaatccgaacctctcacagagtacactagacatacac
tag

KEGG   Equus caballus (horse): 100069613
Entry
100069613         CDS       T01058                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04024  cAMP signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04310  Wnt signaling pathway
ecb04330  Notch signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04520  Adherens junction
ecb04630  JAK-STAT signaling pathway
ecb04720  Long-term potentiation
ecb04916  Melanogenesis
ecb04919  Thyroid hormone signaling pathway
ecb04922  Glucagon signaling pathway
ecb04935  Growth hormone synthesis, secretion and action
ecb05016  Huntington disease
ecb05152  Tuberculosis
ecb05161  Hepatitis B
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100069613 (CREBBP)
   04330 Notch signaling pathway
    100069613 (CREBBP)
   04350 TGF-beta signaling pathway
    100069613 (CREBBP)
   04630 JAK-STAT signaling pathway
    100069613 (CREBBP)
   04066 HIF-1 signaling pathway
    100069613 (CREBBP)
   04068 FoxO signaling pathway
    100069613 (CREBBP)
   04024 cAMP signaling pathway
    100069613 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100069613 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100069613 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100069613 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100069613 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100069613 (CREBBP)
   04916 Melanogenesis
    100069613 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100069613 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100069613 (CREBBP)
   05206 MicroRNAs in cancer
    100069613 (CREBBP)
   05203 Viral carcinogenesis
    100069613 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100069613 (CREBBP)
   05215 Prostate cancer
    100069613 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100069613 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100069613 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100069613 (CREBBP)
   05161 Hepatitis B
    100069613 (CREBBP)
   05164 Influenza A
    100069613 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100069613 (CREBBP)
   05165 Human papillomavirus infection
    100069613 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100069613 (CREBBP)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100069613 (CREBBP)
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100069613 (CREBBP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100069613 (CREBBP)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100069613 (CREBBP)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100069613 (CREBBP)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100069613 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100069613
NCBI-ProteinID: XP_023472188
Ensembl: ENSECAG00000024766
VGNC: 16858
LinkDB
Position
13
AA seq 2452 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSGSTINPGIGNVSASSPVQQGLGGQAQGQPNSANLGSLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFSTDIKNASVTNVPNMSQMQTAVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRMPVSQG
MNSFNPMPLGNVQLPQAPMGPRAASPMNHTVPMNSMGSVPGMAISPSRMPQPPNMMGGHA
NNMMAQAPAQNQFLPQNQFPSPSGALSVNSVGMGQPAAQTGVSQGQVPGAALPNPLNMLG
PQGSQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPP
GTPLSQPAASIDNRVPTPSSVASAETNSQQPGPDVPMLEMKAEVKTEDTEPDASESKGEP
GSAMMEEDLQGSSQVKEETDTAEQKSEPMEVDEKKPEVKVEAKEEEESSANGAVSQSTSP
SQPRRKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADRYHFCEKCFTEIQGE
NVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFV
CDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDK
TVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTR
RVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCH
PPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPN
VLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKK
PSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAF
LTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYD
LCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPA
QPQPSPVSMSPASFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQ
QQQHLYRVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPIP
QQQPMPGMPRPVIPMQAQPAVAGPRMSNVPPPRSISPGALQDLLRTLKSPSSPQQQQQVL
NILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQAQPGLQPQPGLHQQPGLQNLNAMQA
SGPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQ
QQQQQQQGSAGMAGGIAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQ
LGQIGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHL
PGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVT
MASSIDQGHLGNPEQSAMLPQLNTPNRNALSSELSLVGDTTGDTLEKFVEGL
NT seq 7359 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagctgatccccaatggaggagaattaagccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctgcgtggaggcagcggctct
actatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctcggc
ggccaggcccaagggcagccgaacagtgcgaacctgggcagcctaggtgccatgggcaag
agccctctgaaccagggagattcttccgcccccagcctgcccaaacaggcggccagcacc
tctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacaggacctgggatctgcatgaacgctaac
tttaaccagacccatccaggcctcctcaatagtaactctggccatagtttaatgaaccag
gcccagcaagggcaggcgcaagtcatgaatggatcccttggggctgctggcagaggaagg
ggagctggaatgccgtaccctgctccggctatgcagggggccacgagcagtgtgctggct
gagactttaacgcaggtttcaccccaaatggccagtcatgcgggactgaacacggcgcag
gcgggaggcatgaccaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaacccccagttacccagcaaa
cagagcatggtcaatagtttgcctcccttctctacagacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacagcagtgggaatagtacccacacaagcaatt
gcaacgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcacgctcataagtgtcagagacgagaacaagcaaacggagaggttcgggcctgc
tctctcccacattgtcgaaccatgaagaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacacagctg
cagcctcaggttcctggccagcaaccagcacagccacaaactcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggagggataacaacagatcag
cagccaccaaatttgatttcagaatcagctcttccaacttcccttggggccacaaacccg
ctgatgaatgatggctcaaactctggaaacattggaaccctcagcactatacctacagcg
gcacctccttccagcacgggtgttcggaaaggctggcacgaacatgtcactcaggacctg
cggagccatctagtgcataaactcgtccaagccattttcccgacacctgaccctgcagcc
ctaaaggatcgccgcatggagaacctggtggcttatgctaagaaagtggaaggggacatg
tatgagtctgccaacagcagggatgaatactatcacttattagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggaggtcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccctggggcacagccccctgggattccacaggcacaacct
gtgagacctccaaatgggcccatgcccctgccagtgaatcgcatgccggtttctcaaggg
atgaattcatttaacccgatgcccttggggaatgtacagttgccacaagctcccatggga
ccacgcgcagcgtcccccatgaaccacaccgtcccgatgaacagcatgggctccgtcccg
gggatggccatttctccctcccgaatgcctcagcctccgaacatgatgggtggacatgcc
aacaacatgatggcccaggcacctgcgcagaaccagttcctgccacagaaccagttcccg
tcacccagtggggcgctgagtgtgaacagtgtaggcatggggcagccagcagcccagact
ggcgtgtcacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccagggcagccagctgccttgcccaccagtgacacagtcaccgttgcaccagacacca
cctcctgcttccacagctgctggcatgccatctctccagcatccgacggcacctgggatg
actcctccccagccagcagctcccacccagccatcaactcctgtgtcgtcttccgggcag
actcccaccccgactcctggctcagtgcccagtgctagccaaacccagagcacccctacg
gtccaggcagcagcccaggcccaggtgaccccacagcctcagaccccagtccagcccccg
tctgtggccacccctcagtcatcgcagcagcaaccgacacctgtgcatgcccagcctcct
ggcactccgctttcccagccagcagccagcattgataacagggtccccactccatcctca
gtggccagtgccgaaaccaactcccaacagccaggacccgatgtaccaatgctggaaatg
aaggctgaggtcaagacagaggacaccgagcccgatgccagtgaatccaagggggagcct
ggctctgcgatgatggaggaggatttacaaggatcttctcaagttaaagaagaaacagac
acagcagagcagaaatctgaaccgatggaagtagatgaaaagaaaccagaagtgaaagtg
gaagctaaagaggaggaggagagtagcgctaacggagcggtctctcagtccacgtctcct
tcgcagccccgcagaaagatctttaagccggaggagttacgccaggctcttatgccaacc
ctggaagcgctgtatcgacaggatccagagtccttaccttttcggcagcctgtagatccc
cagctcctaggaattccagattattttgacattgtgaagaatcccatggacctttccact
atcaagcggaagctggatacagggcagtaccaagaaccctggcagtatgtggatgatgtc
tggcttatgttcaacaatgcctggctctacaatcgtaagacgtcccgggtctataagttc
tgcagtaaactcgcagaggtctttgagcaagaaattgatcctgtaatgcagtcccttgga
tattgctgtggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcaa
ctgtgtacaattcctcgagatgctgcgtactacagctatcagaatagttcacccaagtat
ggccttcttgctgacaggtatcatttctgtgagaagtgtttcacagagatccagggggag
aatgttaccctgggtgacgacccttcacaaccccagacgacaatttcaaaggatcagttt
gaaaagaagaaaaatgataccttagatcctgaacctttcgttgattgcaaggaatgtggc
cggaagatgcatcagatttgtgttttacactatgatatcatttggccttcaggcttcgtg
tgcgacaactgcttgaagaaaactggcagaactcgaaaagagaacaaattcagtgctaag
aggctgcagaccacacgattgggaaaccacttggaagaccgagtcaacaagtttttgcgg
cgacagaatcatcccgaagccggggaggtctttgtcagagtcgtagccagctcagacaag
actgtggaggtcaagcccgggatgaagtcacggtttgtggattctggggaaatgtctgaa
tctttcccgtatcgaacaaaagccctctttgcttttgaggaaattgacggagtggacgtg
tgcttcttcgggatgcacgtgcaagagtatggctctgactgcccccctccaaacacaagg
cgtgtgtatatatcttacctggacagtattcatttcttccggccccgatgcctccggaca
gctgtttaccatgagatccttattggatatttagaatatgtgaagaaattgggatatgta
acgggacacatctgggcctgtcccccaagtgaaggagatgactacattttccattgccac
cctcctgatcaaaaaatcccgaaaccgaagcgcctgcaggagtggtacaaaaagatgctg
gataaggcatttgcagagcggatcattcatgattacaaggatattttcaaacaagcaact
gaagacaggctcaccagtgccaaggaactaccctattttgagggtgacttctggcccaat
gtattggaggagagcattaaggagctggaacaagaagaagaggagaggaagaaggaagag
agcactgcggccagtgagaccacagagggcagccagggtgatagcaagaatgccaagaag
aagaacaacaagaaaacaaacaagaataaaagcagcatcagccgagccaacaagaagaag
cccagcatgcccaacgtgtccaacgacttgtcccagaagctctatgccaccatggagaag
cacaaagaggtcttctttgtgatccatctccacgccgggcctgtcatcaacacgctgccc
cccatcgtcgaccctgaccccctgctcagctgcgacctcatggatgggcgcgacgccttc
ctcaccctcgccagagacaagcactgggagttctcctccttgcgccggtccaagtggtcc
acgctatgcatgctggtggagctgcacacccagggccaagaccgcttcgtctacacctgc
aatgagtgcaagcaccacgtggagacccgctggcactgcaccgtgtgcgaggactatgac
ctttgcatcaactgctacaacacgaagagccacacccacaagatggtgaagtggggactg
ggcctggacgatgagggcagcagccagggcgagccgcagtctaagagcccccaggagtca
cggcgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaat
gccaactgctcgctgccatcctgccagaagatgaagcgggtcgtgcagcacaccaagggc
tgcaagcgcaagaccaacgggggctgcccggtgtgcaagcagctcattgccctctgctgc
taccatgccaaacactgccaagaaaacaaatgccccgtgcccttctgcctcaacatcaaa
cacaagctccgccagcagcagatccagcaccgcctgcagcaagcccagctcatgcgccgg
cggatggccaccatgaacacccgcaatgtgcctcagcagagtctgccttcccctacctca
gcaccgcccgggacccccacgcaacagcccagcacgccgcagacgccgcagccccctgcc
cagccccagccttcgcctgtgagcatgtcaccagccagcttccccagtgtggcccggact
cagccccccaccacggtgtccactgggaagcccaccaaccaggtaccggcaccaccaccc
cctgcccagcccccacctgcggcggtagaagcggcccggcagattgagcgcgaggcccag
cagcagcagcacctataccgggtgaacatcaacaacggcatgcccccaggacgcacaggc
atggtgacccctgtgagccagatggcccctgtgggcctgaatgtgccccgacccaaccag
gttagtgggcccgtcatgcccaacctgccgccagggcagtggcagcaggcgcccatcccc
caacagcagccaatgccaggcatgcccaggcccgtgatacccatgcaggcccagccggct
gtggctggtccacggatgtccaatgtgccgccacctcggagcatctcgcccggcgccctg
caggacctgctgcggactctgaagtcacccagctccccgcagcagcagcagcaggtgctt
aacatcctcaagtcaaatcctcagctgatggcagctttcatcaagcagcgcacagccaag
tacgtggccagtcagcctggtctgcagccccagcctggcctccaggcccagcctggcctg
cagccccagcccggcctgcaccagcagcctggcctgcagaacctgaacgccatgcaagcc
agcgggccacggcctggcgtgcctccacagcagcaggcaatgggaggcctgaacccccag
ggccaggccctaaacatcatgaacccggggcacaaccccagcatggcaagtatgaaccca
cagtacagagagatgctgcggaggcagctgctacagcagcagcaacaacagcagcagcag
caacagcagcaacagcagcagggtagcgctggcatggccgggggcatagcagggcacggc
caattccagcagcctcaaggacccggaggctacccccctgccatgcagcagcagcggatg
cagcagcacctccccatccagggcagctccatgggccagatggcagctcaaatgggacag
ctgggccagatagggcagcctgggctgggtgcagacagcacccccaacatccagcaggcc
ctgcagcagcggattctgcagcagcagcagatgaaacaacagatcgggtccccgggtcag
ccgaaccccatgagcccccagcagcacatgctctcaggacagccacaggcctcgcacctc
cctggccagcagatggccacgtcccttagtagccaggtgcggtctccggcccctgtccag
tctccgcggccccagtcccagcctccacattccagcccgtcgccgcggatacagccccag
ccttcgccacaccacgtctcgccccagactggttccccccacccaggactcgcagtcacc
atggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctccca
cagctgaacacccccaacaggaatgcgttgtccagtgagctgtccctggtcggcgacacc
acaggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system