KEGG   Equus caballus (horse): 100055670
Entry
100055670         CDS       T01058                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04020  Calcium signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04072  Phospholipase D signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04611  Platelet activation
ecb04625  C-type lectin receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04919  Thyroid hormone signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100055670 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100055670 (PLCG2)
   04014 Ras signaling pathway
    100055670 (PLCG2)
   04370 VEGF signaling pathway
    100055670 (PLCG2)
   04064 NF-kappa B signaling pathway
    100055670 (PLCG2)
   04066 HIF-1 signaling pathway
    100055670 (PLCG2)
   04020 Calcium signaling pathway
    100055670 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100055670 (PLCG2)
   04072 Phospholipase D signaling pathway
    100055670 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055670 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100055670 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100055670 (PLCG2)
   04662 B cell receptor signaling pathway
    100055670 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100055670 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100055670 (PLCG2)
   04670 Leukocyte transendothelial migration
    100055670 (PLCG2)
   04062 Chemokine signaling pathway
    100055670 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100055670 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100055670 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100055670 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100055670 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100055670 (PLCG2)
   04380 Osteoclast differentiation
    100055670 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055670 (PLCG2)
   05206 MicroRNAs in cancer
    100055670 (PLCG2)
   05205 Proteoglycans in cancer
    100055670 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100055670 (PLCG2)
   05214 Glioma
    100055670 (PLCG2)
   05223 Non-small cell lung cancer
    100055670 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100055670 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055670 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100055670 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100055670 (PLCG2)
   05169 Epstein-Barr virus infection
    100055670 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100055670 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100055670 (PLCG2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100055670 (PLCG2)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100055670 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100055670 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 100055670
NCBI-ProteinID: XP_001502048
Ensembl: ENSECAG00000000291
VGNC: 21543
LinkDB
Position
3
AA seq 1265 aa
MNTMVNVNALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKSSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSREDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEHWAQDLNRVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCGVEQQRHMARV
FKEVFGDQLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTGEEEPPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYY
LTDNLMFTSIYALIQHYRETHLRCAEFELRLTEPVPNPNPHEAKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRARGKVKHCRINKDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPIDLLKYNQKGLTRIYPKGQRVDSSNYDPFRFWLCGSQMAALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaacaccatggtcaatgtgaacgcccttccggaatacgagaagagtcagatcaagagg
gccctggagctgggcacagtgatgaccgtgttcagcttccgcaagtccacgccggagcgc
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagacggccgacaag
atcgagggcttcttggatatcatggaaataaaggaaatccgcccagggaagagctccaag
gattttgagcgtgcgaaagccgtccgccagaaggaagactgctgcttcaccatcttgtac
ggcacccagttcgtcctcagcacactcagtttggcagctgactctagagaagatgcaact
aagtggctgtctggcttgaaaatcttacaccaggaagcgatgagtgcgtccacacccacc
attattgagagttggctgagaaagcagatttattctgtggatcaaaccagaaggaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagtgcc
aagttcctgaaagataagtttgtggaaataggcgcgcacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaagtcgattcttgacgaa
ttcaaaaaggattcttctgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gttcacctgcacgacttccagcggtttctcttacatgaacagcaggaacactgggctcag
gatctgaacagagtccgtgagcggatgacaaagttcatcgacgacacgatgagggaaact
gctgagcccttcttgttcgtcgatgagttcctcacgtacctgttttcacgggagaacagc
atctgggatgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtcacat
tactggatctcctcatcccacaatacgtacctcacaggtgaccagctgcggagcgagtcg
tccacggaagcgtacatccgctgtctgcggatgggctgtcgctgcatcgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgatgtcgtgcaggccatcaaagaccacgcctttgtcacctcgagcttcccc
gtgatcctgtccatcgaggagcactgtggcgtggagcagcagcgccacatggccagggtc
ttcaaggaggtgtttggcgaccagctgctgatgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacatggaggacaagaaggatgaacacaagcaacagggtgaa
ctgtacatgtgggattccattgaccagaaatggactcggcactactgtgccattgctgat
gccaagctgtcctttagcgacgacattgaacagaccggggaagaggagccaccccaggat
acaccccccacagagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acaagtgccgagaagctgctacaggaatactgtgccgagaccgggggcaaggatgggacc
ttcttggtgcgagagagcgagaccttccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcactgccggatccgctccaccatggagggcgggaccatgaagtactac
ctgactgacaacctcatgtttaccagcatctacgccctcatccagcattaccgcgagacg
cacctgcgctgcgccgagttcgagcttcggctcaccgagcccgtgcccaaccccaacccc
cacgaggcaaagccgtggtactacgacgggctgagccgcggagaagcagaggacatgctg
atgagggttccccgggacggggccttcctgatccggaagcgggaaggcacggactcctac
gccatcaccttcagggccaggggcaaagtgaagcactgtcgcatcaacaaggacggccgg
cactttgtgctggggacctccgcctacttcgagagcctcgtggagctcgtcagttactac
gagaagcatgcgctctaccgaaagatgaggctgcgctaccccgtgactcccgagctgctg
gagcgctacaatatggaaagagatataaactccctctatgacgtcagcagaatgtatgtg
gatcccagcgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagtgatgagctgagcttctgccgtggcgccctcatccacaacgtctcc
aaggagcccgggggctggtggaaaggagactatgggaccagaatccagcaatactttccg
tctaattacgtcgaggacatctcaacagctgacgtggaggagctggaaaagcagattatt
gaagacaatcccttagggtctctctgcagaggaatattggatctcaacacctataacgtt
gtgaaagccccacaggggaaaaaccagaagcctttcgtctttatcctggagcccaagaag
cagggcgatcctccggtggagtttgccacggacagggtggaggagctctttgagtggttt
cagagcatccgggagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtcgatcgccatcgagctctcagacctggtcgtctactgcaagccaacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctcgtttgtggag
acgaaggcggacagtgtggtcagacagaaacccatcgatctcctgaagtacaatcaaaag
ggcctgacccgcatttaccccaagggacagagggtggactcctccaactacgaccccttc
cgcttctggctgtgtggctcccagatggcggcactcaatttccagactgcagataagtac
atgcagatgaaccacgccttgttttcactcaatgggcggacgggctacgtcctacagcct
gagagcatgaggacggagaagtacgaccccatgccgcccgagtcccagaggaagatcctg
atgactttgacggtcaaggttcttggggctcgccatctccccaaacttggacggagtatt
gcatgtccctttgtggaggtggaaatatgtggagccgaatatgacaacaacaagtttaag
acgacagttgtgaatgacaatggcctaagccctgtttgggctccaacacaggagaaggtg
acgtttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtttatgaggaagat
atgttcagtgatcccaactttcttgctcatgccacttaccccattaaagggatcaaatca
ggatttagatctgttcctctgaagaatgggtacagtgaagacattgagctggcttccctc
ctggttttctgtgagatgcggcccgtcctggagagcgaagaggaactctactcctcctgt
cgccagctgcggaggcggcaggaagagctgaacaaccagctctttctgtacgacacacac
cagaacttgcgcaatgccaaccgggatgccctcgttaaagagttcaacgtcaacgagaac
cagctccagctgtaccaggagaagtgcaaccggaggttaagagagaagagagtgagcaac
agcaagttttactcctag

KEGG   Equus caballus (horse): 100070545
Entry
100070545         CDS       T01058                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X3
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00562  Inositol phosphate metabolism
ecb01100  Metabolic pathways
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04072  Phospholipase D signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04919  Thyroid hormone signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04935  Growth hormone synthesis, secretion and action
ecb05012  Parkinson disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05135  Yersinia infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
ecb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100070545 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100070545 (PLCG1)
   04014 Ras signaling pathway
    100070545 (PLCG1)
   04015 Rap1 signaling pathway
    100070545 (PLCG1)
   04370 VEGF signaling pathway
    100070545 (PLCG1)
   04064 NF-kappa B signaling pathway
    100070545 (PLCG1)
   04066 HIF-1 signaling pathway
    100070545 (PLCG1)
   04020 Calcium signaling pathway
    100070545 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100070545 (PLCG1)
   04072 Phospholipase D signaling pathway
    100070545 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100070545 (PLCG1)
   04660 T cell receptor signaling pathway
    100070545 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100070545 (PLCG1)
   04659 Th17 cell differentiation
    100070545 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100070545 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100070545 (PLCG1)
   04670 Leukocyte transendothelial migration
    100070545 (PLCG1)
   04062 Chemokine signaling pathway
    100070545 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100070545 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100070545 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100070545 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100070545 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100070545 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070545 (PLCG1)
   05206 MicroRNAs in cancer
    100070545 (PLCG1)
   05205 Proteoglycans in cancer
    100070545 (PLCG1)
   05231 Choline metabolism in cancer
    100070545 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100070545 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100070545 (PLCG1)
   05214 Glioma
    100070545 (PLCG1)
   05223 Non-small cell lung cancer
    100070545 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100070545 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100070545 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100070545 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100070545 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100070545 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100070545 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100070545 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100070545 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100070545 (PLCG1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100070545 (PLCG1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100070545 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100070545 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 GDPD PH_9
Other DBs
NCBI-GeneID: 100070545
NCBI-ProteinID: XP_005604689
Ensembl: ENSECAG00000021031
VGNC: 21542
LinkDB
Position
22
AA seq 1160 aa
MWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNM
RFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSL
PEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSVWN
SQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDG
PDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKK
VLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIK
NGILYLEDPVNHEWYPHYFVLTSSKIYYSEETNSDQGNEDEEEPKETSGSTELHSNEKWF
HGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIH
SRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHA
SLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEF
DSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPT
FKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVS
PAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSISMASMAHWSLDV
AADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIG
TERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWIC
GSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAIC
IEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISN
PEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDV
FPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFEARYQQPFEDFRISQEHLADH
FDSRERRAPRRTRVNGDNRL
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgtggatcaagggcttaacttggttgatggaggatactttgcaggcggccacacccctg
cagattgagaggtggctgcggaagcagttctactcagtggatcgaaaccgtgaggaccgt
atatcagccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatg
cgcttccttcgagagcggctaacggacctggagcagcgcagcagcgacatcacctatggg
cagtttgctcagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccct
ttcttggaagccagtgccctgagggctggggagcggccagagctctgccgagtgtcactt
cctgagttccagcagtttctcctcgagtaccagggggagctgtgggctgttgaccggctc
caggtgcaggagtttatgctcagcttcctcagagaccccttgcgagagattgaggagcca
tacttcttcctggacgagttcgtcaccttcctattctccaaagagaacagtgtgtggaac
tcacagctggatgcagtgtgcccagacaccatgaacaaccctctctctcactactggatc
tcctcctcgcacaatacgtatctgaccggggaccagttctccagcgagtcctccctggaa
gcctatgctcgctgcctgcggatgggctgtcgctgcattgagttggactgttgggacggc
ccagacgggatgcctgtcatttaccacggacacacccttaccaccaagatcaagttctca
gatgtcctgcacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctg
tccatcgaggaccactgcagtattgcccagcaaaggaacatggcccagtacttcaagaag
gtgctcggggacacactcctcaccaagcctgtggacatcgccgcagatgggctgccttca
cccaatcagctcaagaggaagatccttatcaagcacaagaagctggctgagggtagtgcc
tatgaggaggtgcctacatctgtgatgtactcagagaacgacatcagcaactccatcaag
aatggcatcctctacctggaggaccctgtgaaccatgagtggtatccccactactttgtt
ctgaccagcagcaagatctactactctgaggagaccaacagtgaccagggcaatgaggat
gaggaggagcccaaggagaccagcggcagcacagagctgcactccaacgagaagtggttc
catgggaagctcggggcaggacgggacgggcggcacatcgccgagcgcctgctcaccgag
tactgcattgagaccggggcccccgatggctccttcctagtgcgcgagagcgagaccttt
gtgggcgactacaccctctctttctggcggaacgggaaagtccagcactgcaggatccac
tctcggcaggatgctgggacccccaagttcttcttaacagacaacctcgtctttgactcc
ctctatgacctcatcacacactaccagcaggtgcccctgcgctgcaacgaatttgagatg
cgcctctcagagcctgtcccacagaccaatgcccacgagagcaaagagtggtaccacgca
agcctgaccagagcacaggctgagcacatgctgatgcgtgtcccccgtgatggtgcattc
ctggtgcggaaacggaatgagcccaactcttacgccatatccttccgggccgagggcaag
attaagcattgccgtgtccagcaggagggccagactgtgatgctgggcaactcggagttt
gacagcctcgttgacctcatcagctactatgagaagcatccgctgtaccgcaagatgaaa
ctgcgctatcccatcaacgaggaggcgctggagaagattggcacagctgagcctgactac
ggggccctgtatgagggacgcaaccctggcttctatgtggaagcaaaccctatgccgact
ttcaagtgtgcagttaaagccctctttgactacaaggcccagagagaggatgagctgact
ttcaccaagagcgccatcatccagaatgtggagaagcaagagggaggctggtggcgaggg
gactatggtgggaagaagcagctgtggttcccatccaactacgtggaagaaatggtcagt
ccagcggccctggagcctgaaagggagcacttggacgagaacagccctctgggggacttg
ctgcggggggtcttggatgtgccagcttgtcagattgccatccgtcctgagggcaagaac
aaccggctcttcgtcttctccatcagcatggcgtccatggcacactggtccctggatgtt
gctgctgactctcaggaggagctgcaggactgggtgaaaaagatccgagaagtggcccag
accgcagatgccaggctcactgaggggaagatgatggaacggaggaagaagattgccctg
gagctctccgagcttgttgtctactgccgacctgttccttttgatgaagagaagattggc
acagaacgtgcctgctaccgggacatgtcatcctttccggaaaccaaggctgagaaatat
gtgaacaaggccaaaggcaagaagttcctccagtacaaccggctccagctctcccgcatc
taccccaagggccagcggctggactcctccaattacgatcccttgcccatgtggatctgt
ggcagtcagctggtggccctcaacttccagaccccagacaagcctatgcagatgaaccag
gccctcttcatggccggcgggcactgtggctacgtgctgcagccaagcaccatgcgggac
gaggccttcgacccctttgacaagagcagcctccgtgggctagagccatgcgccatctgc
atcgaggtgctgggggcccggcatctgccaaagaatggccgaggcattgtgtgtcctttt
gtggagattgaggtggctggagctgagtatgacagcaccaagcagaagacagagtttgtg
gtggacaatggactgaaccccgtgtggccagccaagcccttccacttccagatcagtaac
cccgaattcgccttcctgcgctttgtagtgtatgaggaagacatgtttagtgaccagaac
ttcctggcccaggctactttcccggtgaaaggcctgaagacaggatatagagcggtgcct
ttgaaaaacaactacagtgaggacctggagctggcctccctgctcgtcaagatcgacgtt
ttccctgccaagcaggagaacggcgacctcagtcccttcagtggtacgtccctgcgggaa
cggggctctgatgcctcgggccagctgtttcatggccgggcccgggaaggctcctttgaa
gcccgctaccagcagccatttgaggactttcgcatctcccaggagcaccttgcagaccat
tttgacagtcgggaacgaagggccccacgaaggactcgggtcaacggagacaatcgcctc
tag

DBGET integrated database retrieval system