KEGG   Equus caballus (horse): 100055673
Entry
100055673         CDS       T01058                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100055673 (GNAI1)
   04371 Apelin signaling pathway
    100055673 (GNAI1)
   04071 Sphingolipid signaling pathway
    100055673 (GNAI1)
   04024 cAMP signaling pathway
    100055673 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100055673 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100055673 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100055673 (GNAI1)
   04670 Leukocyte transendothelial migration
    100055673 (GNAI1)
   04062 Chemokine signaling pathway
    100055673 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100055673 (GNAI1)
   04915 Estrogen signaling pathway
    100055673 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100055673 (GNAI1)
   04921 Oxytocin signaling pathway
    100055673 (GNAI1)
   04926 Relaxin signaling pathway
    100055673 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    100055673 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100055673 (GNAI1)
   04916 Melanogenesis
    100055673 (GNAI1)
   04924 Renin secretion
    100055673 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100055673 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100055673 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100055673 (GNAI1)
   04727 GABAergic synapse
    100055673 (GNAI1)
   04725 Cholinergic synapse
    100055673 (GNAI1)
   04728 Dopaminergic synapse
    100055673 (GNAI1)
   04726 Serotonergic synapse
    100055673 (GNAI1)
   04730 Long-term depression
    100055673 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100055673 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    100055673 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100055673 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055673 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100055673 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100055673 (GNAI1)
   05032 Morphine addiction
    100055673 (GNAI1)
   05034 Alcoholism
    100055673 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100055673 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100055673 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100055673 (GNAI1)
   05163 Human cytomegalovirus infection
    100055673 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100055673 (GNAI1)
   05142 Chagas disease
    100055673 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100055673 (GNAI1)
   04031 GTP-binding proteins [BR:ecb04031]
    100055673 (GNAI1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100055673 (GNAI1)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100055673 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100055673
NCBI-ProteinID: XP_023494588
Ensembl: ENSECAG00000000229
VGNC: 18415
LinkDB
Position
4
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYRAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSALTICYPEYAGSNTYEEAA
AYIQCQFEELNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcgcagcaagatgatcgac
cgcaacctgcgcgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctgggaaaagcaccattgtgaagcagatgaagatcatccacgaagccggt
tattcggaagaggagtgtaaacagtacagagctgtggtatacagcaacaccatccagtcc
atcattgccatcatcagggccatgggccggctcaagatagacttcggcgactcagcgcgg
gcggatgatgcccgccagctcttcgtgctcgcgggggccgctgaggaaggtttcatgacg
gcggagctggccggggttataaagaggttgtggaaagacagcggtgtgcaggcctgtttc
aacagatcccgcgagtaccagctcaacgattccgcagcatactacctgaatgacttggac
agaatagcacaaacaaattacatccccactcaacaagacgttctcagaactagagtgaaa
actacaggaatcgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggacagaggtccgagcggaagaaatggatccactgcttcgaaggcgtgaccgcc
atcatcttctgtgtggcgctgagcgactacgacctggttctggccgaagacgaagagatg
aatcggatgcacgaaagcatgaagttgttcgacagcatatgtaacaacaaatggtttaca
gacacttctattatcctttttctaaacaagaaggatctctttgaggagaaaatcaagaag
agtgccctcaccatatgctatccggaatatgcaggctcgaacacgtatgaagaggcagcc
gcatacatccagtgtcagtttgaagagctcaataagagaaaggacacgaaggagatatac
acccacttcacgtgtgccaccgacacgaagaacgtgcagttcgttttcgacgccgtaacg
gatgtcatcataaaaaataacctgaaggattgtggtctcttctga

KEGG   Equus caballus (horse): 100058238
Entry
100058238         CDS       T01058                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100058238 (GNAI3)
   04371 Apelin signaling pathway
    100058238 (GNAI3)
   04071 Sphingolipid signaling pathway
    100058238 (GNAI3)
   04024 cAMP signaling pathway
    100058238 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100058238 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100058238 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100058238 (GNAI3)
   04670 Leukocyte transendothelial migration
    100058238 (GNAI3)
   04062 Chemokine signaling pathway
    100058238 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100058238 (GNAI3)
   04915 Estrogen signaling pathway
    100058238 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100058238 (GNAI3)
   04921 Oxytocin signaling pathway
    100058238 (GNAI3)
   04926 Relaxin signaling pathway
    100058238 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    100058238 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100058238 (GNAI3)
   04916 Melanogenesis
    100058238 (GNAI3)
   04924 Renin secretion
    100058238 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100058238 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100058238 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100058238 (GNAI3)
   04727 GABAergic synapse
    100058238 (GNAI3)
   04725 Cholinergic synapse
    100058238 (GNAI3)
   04728 Dopaminergic synapse
    100058238 (GNAI3)
   04726 Serotonergic synapse
    100058238 (GNAI3)
   04730 Long-term depression
    100058238 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100058238 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    100058238 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100058238 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058238 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100058238 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100058238 (GNAI3)
   05032 Morphine addiction
    100058238 (GNAI3)
   05034 Alcoholism
    100058238 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100058238 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100058238 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100058238 (GNAI3)
   05163 Human cytomegalovirus infection
    100058238 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100058238 (GNAI3)
   05142 Chagas disease
    100058238 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100058238 (GNAI3)
   04031 GTP-binding proteins [BR:ecb04031]
    100058238 (GNAI3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100058238 (GNAI3)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100058238 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 100058238
NCBI-ProteinID: XP_023497233
VGNC: 50840
LinkDB
Position
5
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacactgagcgccgaagacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctcctcggt
gctggagaatctggtaaaagcactatcgtgaaacagatgaaaatcattcatgaggacggc
tattcagaggaagaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggagaagctgccaga
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtgcaagcttgcttc
agcagatctagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaagcaactacattccaacccagcaagatgtcctgcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaagcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
actcacttcacctgtgccacggacaccaagaatgtacagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Equus caballus (horse): 100062085
Entry
100062085         CDS       T01058                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04360  Axon guidance
ecb04371  Apelin signaling pathway
ecb04540  Gap junction
ecb04611  Platelet activation
ecb04670  Leukocyte transendothelial migration
ecb04713  Circadian entrainment
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04727  GABAergic synapse
ecb04728  Dopaminergic synapse
ecb04730  Long-term depression
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb04924  Renin secretion
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04971  Gastric acid secretion
ecb05012  Parkinson disease
ecb05030  Cocaine addiction
ecb05032  Morphine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100062085 (GNAI2)
   04371 Apelin signaling pathway
    100062085 (GNAI2)
   04071 Sphingolipid signaling pathway
    100062085 (GNAI2)
   04024 cAMP signaling pathway
    100062085 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100062085 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100062085 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100062085 (GNAI2)
   04670 Leukocyte transendothelial migration
    100062085 (GNAI2)
   04062 Chemokine signaling pathway
    100062085 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100062085 (GNAI2)
   04915 Estrogen signaling pathway
    100062085 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100062085 (GNAI2)
   04921 Oxytocin signaling pathway
    100062085 (GNAI2)
   04926 Relaxin signaling pathway
    100062085 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    100062085 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100062085 (GNAI2)
   04916 Melanogenesis
    100062085 (GNAI2)
   04924 Renin secretion
    100062085 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100062085 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100062085 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100062085 (GNAI2)
   04727 GABAergic synapse
    100062085 (GNAI2)
   04725 Cholinergic synapse
    100062085 (GNAI2)
   04728 Dopaminergic synapse
    100062085 (GNAI2)
   04726 Serotonergic synapse
    100062085 (GNAI2)
   04730 Long-term depression
    100062085 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100062085 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    100062085 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100062085 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062085 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100062085 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100062085 (GNAI2)
   05032 Morphine addiction
    100062085 (GNAI2)
   05034 Alcoholism
    100062085 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100062085 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100062085 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100062085 (GNAI2)
   05163 Human cytomegalovirus infection
    100062085 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100062085 (GNAI2)
   05142 Chagas disease
    100062085 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100062085 (GNAI2)
   04031 GTP-binding proteins [BR:ecb04031]
    100062085 (GNAI2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100062085 (GNAI2)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100062085 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 100062085
NCBI-ProteinID: XP_023476151
Ensembl: ENSECAG00000000489
VGNC: 18416
LinkDB
Position
16
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcactgtgagcgccgaggacaaggcggcggccgagcgctccaagatgatcgac
aagaatctgcgggaagacggcgagaaagcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcaggaaagagcaccattgtcaagcagatgaagatcatccatgaggatggt
tactcagaggaggaatgccggcagtaccgggcagtcgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaatctgcagattgactttgccgacccctctcgt
gcggacgacgccaggcagctgtttgcgctctcctgcacggccgaggagcagggcgtgctc
cctgaggacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctctcgggagtaccagctcaacgactccgccgcctactacctgaacgacctg
gagcgcatcgcccagagtgactatatccccacacagcaggatgtgctacgaacccgcgtg
aagaccacaggcatcgtagagacacacttcaccttcaaggacctacacttcaagatgttt
gatgttggtggtcagcggtctgagcggaagaaatggatacactgctttgagggtgtcaca
gccatcatcttctgcgtagccttgagcgcctacgacctggtgctagctgaggatgaggag
atgaaccgcatgcacgagagcatgaagctgtttgacagtatctgcaacaacaagtggttc
acggacacgtccatcattctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagccccctgaccatctgcttccccgagtacacaggggccaacaagtacgacgaagcg
gccagctacatccagagtaagtttgaagacctgaacaagcgcaaggacaccaaggaaatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

DBGET integrated database retrieval system