KEGG   Equus caballus (horse): 100055698
Entry
100055698         CDS       T01058                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04114  Oocyte meiosis
ecb04140  Autophagy - animal
ecb04144  Endocytosis
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04730  Long-term depression
ecb04913  Ovarian steroidogenesis
ecb04914  Progesterone-mediated oocyte maturation
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100055698 (IGF1R)
   04014 Ras signaling pathway
    100055698 (IGF1R)
   04015 Rap1 signaling pathway
    100055698 (IGF1R)
   04066 HIF-1 signaling pathway
    100055698 (IGF1R)
   04068 FoxO signaling pathway
    100055698 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100055698 (IGF1R)
   04152 AMPK signaling pathway
    100055698 (IGF1R)
   04150 mTOR signaling pathway
    100055698 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100055698 (IGF1R)
   04140 Autophagy - animal
    100055698 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100055698 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100055698 (IGF1R)
   04520 Adherens junction
    100055698 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100055698 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100055698 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100055698 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100055698 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100055698 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100055698 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100055698 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100055698 (IGF1R)
   05205 Proteoglycans in cancer
    100055698 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100055698 (IGF1R)
   05214 Glioma
    100055698 (IGF1R)
   05218 Melanoma
    100055698 (IGF1R)
   05215 Prostate cancer
    100055698 (IGF1R)
   05224 Breast cancer
    100055698 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100055698 (IGF1R)
   01522 Endocrine resistance
    100055698 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100055698 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100055698 (IGF1R)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100055698 (IGF1R)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100055698 (IGF1R)
CD molecules [BR:ecb04090]
 Proteins
  100055698 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100055698
NCBI-ProteinID: XP_023506947
Ensembl: ENSECAG00000021238
VGNC: 18968
LinkDB
Position
1
AA seq 1367 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYFYAGVCVPTCPPNTYRFEGWRCVDRDFCANIPSAEGSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQIANTTMSSRSRNTTMADTYNVTDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVPAKTTYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMESGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccgggcatcgacatccgc
aacgactaccagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaagcagaggactaccgcagctaccgcttccccaagctcacggtc
atcactgaatacttgctgctgttccgcgtggccggcctcgagagccttggtgacctcttc
ccgaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccaatctcaaagatattgggctttacaacctgaggaacatcactcggggggcc
atcaggattgagaaaaatgctgacctttgttacctctccacggtggactggtccctgatc
ctggatgcagtgtccaataactacatcgtgggaaacaaacccccaaaagaatgcggggac
ctgtgtccagggacaatggaggagaagccattgtgcgagaagaccaccatcaacaacgag
tacaactaccgctgctggactacaaatcgctgccagaaaatgtgcccgagcgcgtgcggg
aagcgggcgtgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacaacgacacggcctgcgtcgcctgccgccactacttctacgccggcgtctgc
gtgcccacctgcccgcccaacacctatcgctttgagggctggcgctgcgtggaccgcgac
ttctgtgccaacatccccagcgccgagggcagcgactctgagggcttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcggggttcatccgcaacggcagtcagagcatgtat
tgcatcccttgtgaaggtccttgccccaaagtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcaaatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaatatccgacgaggcaataacattgcctcggaactggagaacttcatggggctc
atcgaggtggtgacaggctacgtgaagatccgccattcccatgccttagtctccttgtcc
ttcctgaagaacctccgccagatcttaggagaggagcagctggaggggaattactccttc
tacgtcctcgacaaccagaacttacagcagctgtgggactgggaccaccgcaacctgacc
atcaaagctgggaaaatgtacttcgctttcaatcccaaattgtgtgtctccgaaatttac
cgcatggaggaagtgacgggcactaaagggcgccagagcaaaggggacatcaacaccagg
aacaacggagagagagcctcctgtgagagtgatgtcctgcacttcacctccaccaccacg
tggaagaatcgcatcatcataacctggcatcgctaccggccccctgactacagggacctc
atcagcttcactgtctactacaaagaggcaccctttaaaaacgtcacagagtatgatggg
caggatgcctgtggctccaacagctggaacatggtggatgtggacctccctcccaacaag
gacgtcgagcctggcattctactgcacgggctgaagccctggacgcagtacgccgtttac
gtcaaggccgtgactctcaccatggtagagaacgaccacattcgtggggccaagagtgaa
atcttgtacattcgcaccaatgcttcagttccttccatccccctggatgttctttcagca
tcaaactcctcttctcagctaattgtgaagtggaacccaccctctctgcccaacggcaac
ctgagttactacatcgtgagatggcagcgacagcctcaggacagctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgatggcaccattgatgtt
gaagaggtgacggagaatcccaagaccgaagtgtgtggtggagagaaagggccttgctgt
gcttgccccaaaaccgaagccgagaagcaggccgagaaggaggaagccgagtaccgcaaa
gtctttgagaatttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcatgcagattgccaacactaccatgtccagccgaagcaggaacaccacgatggca
gacacctacaatgtcacagacccagaggagctggagacagaataccctttctttgagagc
agagtggacaacaaggagaggactgtcatttctaacctccggccattcactttgtaccgc
attgacatccacagctgtaaccacgaggctgagaagctaggctgcagtgcctccaacttc
gtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtgacctgg
gagccaaggcctgaaaattccatctttttaaagtggccagaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatatggatcacaaatcgaggatcagcgagaatgtgta
tccagacaggagtacaggaagtatggaggggccaagcttaaccggctcaaccccgggaac
tatacggcccggatccaggccacctctctctctggaaatgggtcgtggactgatcctgtg
ttcttctatgtcccggccaaaacgacatatgaaaatttcatccatctgatcattgctctg
cctgttgccgtcctgttgatagtgggagggttggttataatgttgtacgtcttccataga
aaaagaaataacagcaggctggggaatggagtgctgtatgcatctgtgaacccagagtac
ttcagcgcagctgatgtgtatgtccctgatgagtgggaggtcgctcgggagaagatcacc
atgagccgagagctgggacagggctcctttgggatggtatatgaaggagttgccaagggc
gtggtcaaagatgagcctgaaaccagagtggccattaaaacggtgaacgaggctgcaagc
atgcgtgaaaggattgaatttctcaatgaggcttcagtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggtgtggtgtcccagggccagccaacgctggtcatcatggag
ctgatgacacggggggatctcaaaagttatctcaggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctaagcaagatgatccagatggctggagagattgca
gacggcatggcatacctcaatgccaacaagttcgtccacagagaccttgccgcccggaac
tgcatggtggccgaagatttcacagtcaaaattggagattttggtatgacgagagatatc
tatgagacagactattaccggaaaggagggaagggattgctgcctgtgcgctggatgtcg
cccgagtccctcaaggatggagtcttcaccactcattctgacgtctggtcctttggggtt
gtcctctgggagattgccacgctggccgagcagccataccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctagacaagccggacaactgccctgacatg
ctgtttgagctgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaggacgagatggagtctggctttcgggaggtctccttctac
tatagcgaggagaacaagccacccgagccagaggagctggacctggagccggagaacatg
gagagtgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgacagacac
tcaggacacaaggccgagaacggcccaggccctggcgtgctggttctccgagccagcttt
gatgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggccttgcct
ctgccccagtcttcgacctgctga

KEGG   Equus caballus (horse): 100056013
Entry
100056013         CDS       T01058                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb05100  Bacterial invasion of epithelial cells
ecb05144  Malaria
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05218  Melanoma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100056013 (MET)
   04014 Ras signaling pathway
    100056013 (MET)
   04015 Rap1 signaling pathway
    100056013 (MET)
   04020 Calcium signaling pathway
    100056013 (MET)
   04151 PI3K-Akt signaling pathway
    100056013 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100056013 (MET)
   04520 Adherens junction
    100056013 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100056013 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056013 (MET)
   05202 Transcriptional misregulation in cancer
    100056013 (MET)
   05206 MicroRNAs in cancer
    100056013 (MET)
   05205 Proteoglycans in cancer
    100056013 (MET)
   05230 Central carbon metabolism in cancer
    100056013 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100056013 (MET)
   05226 Gastric cancer
    100056013 (MET)
   05218 Melanoma
    100056013 (MET)
   05211 Renal cell carcinoma
    100056013 (MET)
   05223 Non-small cell lung cancer
    100056013 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100056013 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100056013 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100056013 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100056013 (MET)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100056013 (MET)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100056013 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like Ninjurin
Other DBs
NCBI-GeneID: 100056013
NCBI-ProteinID: NP_001107619
Ensembl: ENSECAG00000010385
VGNC: 20111
UniProt: Q2QLA9
LinkDB
Position
4
AA seq 1381 aa
MKAPAVLAPGILVLLFTLVQKSDGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGATNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSRKANLSGGAWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPLNNVADIQSEVYCMYSPQAEEPHQCPDCVVSAL
GTKVLLSEKDRFVTFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLPE
FRDSYPIKYIHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECIL
TEKRRKRSTSEEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQSKPDSAEPMNRS
AVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPHHEHCFNRTLLRNSSGCEVRNDEYRTEF
TTALQRVDLFMGQFNQVLLTSISTFIKGNLTIANLGTSEGRFMQVVVSRSGSSTPHVNFH
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCGW
CHDKCVRLEECHNGTWTQEICLPTIYKVFPTSAPLEGGTTLTVCGWDFGFRKNNKLDSKK
TKVLLGNESCTLTLSESTSNTLKCTVGPAMNERFNISITVSNSRGTARYSTFSYVDPIIT
SISPSYGPKTGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTEF
PVKLKIDLANREMNSFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVLRMVINVR
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNPV
FKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPSDL
LKLNSELNIEWKQAVSSTILGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKRRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEVD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcacctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcgatggggagtgtaaagaggcgctagtaaagtccgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaacgtcgttttacacaagcat
cacatttacctcggggccactaactacatttatgttttaaatgacaaagatcttcagaaa
gttgctgagtacaagactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccgcaaagccaatttatcaggtggcgcttggaaagataacatcaacatggctctg
cttgttgacacatactatgacgatcaactcattagttgcggcagcgtccacagagggacc
tgccagcggcacgtccttccactcaacaatgttgctgacatacagtcagaagtttattgc
atgtactctccacaagcagaagagccccaccagtgtcctgactgtgtggtgagtgccctg
ggaaccaaagtcctgctgtctgaaaaggaccgatttgtcaccttcttcgtgggcaatacc
ataaattcttcttaccttccagatcattcattgcattcgatatcggtgagaaggctaaag
gaaacgcaagatggttttaagtttttgacagatcagtcctatattgatgttctacctgag
ttccgagattcttaccccattaagtatatccacgcctttgaaagcaaccattttatttac
tttttaacggtccaacgggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccgtggactctggattgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaagaaagagatccacaagtgaggaagtgtttaatatcctccaagctgcg
tatgtcagtaagcctggggctcatcttgctaagcaaataggtgccaacctgaatgatgac
attctctatggggtgtttgcacagagcaagccagattctgctgaaccaatgaatcgctct
gccgtctgtgcattccctgtcaaatatgtcaatgaattcttcaacaagattgtcaacaaa
aacaacgtgagatgtctccagcatttttatggaccccaccatgaacactgcttcaatagg
acacttttgagaaattcatcaggctgtgaagtgcgcaatgatgaatatcgaacggagttt
accacagctttgcagcgcgttgacttgttcatgggccaattcaaccaagtcctcttgaca
tctatatccaccttcattaaaggaaacctcactatagctaatcttgggacatcagaaggt
cgcttcatgcaggttgtggtttctcgatcaggatcgtcaacccctcatgtgaattttcac
ctggattcccaccctgtgtctccagaagtgattgtggaacacccattaaaccaaaatggt
tacacactggttgtcaccgggaaaaagatcaccaagatcccactgaatggcttgggctgt
gaacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcagtgtggctgg
tgccacgacaaatgtgtgcgattggaggaatgccacaacggaacatggactcaagagatc
tgtctgcctacaatctacaaggttttcccaaccagtgcccccctcgaaggagggacaacg
ctgacagtatgtggctgggactttggattcaggaagaataataaacttgattcaaagaaa
accaaagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgtcaaat
acgttgaaatgcacagttggtcctgcaatgaatgagcgtttcaatatatccataactgtt
tccaacagtcgagggacagcacgatatagtacattttcctatgtggatcctataataaca
agtatttctccaagttatggtcctaagactggtggcactttacttactttaactggaaag
tacttaaacagtgggaattctagacacatttcaattggtggaaaaacatgtaccttaaaa
agtgtgtcagatagtattcttgaatgttatactccagcccaaaccactccaactgagttt
cccgttaaactgaaaattgacttagccaaccgagagatgaacagcttcagttaccgggaa
gaccccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaatt
acaggtgttggaaaaaatctgaattcggttagtgtcctgaggatggtgataaatgtgcgt
gaagcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtacaactccttcactacaacagctgaatttgcaactccctctgaaaaccaaagccttc
ttcatgttggacgggatccattccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagccgttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacactcacattctgaagccgttttatgtacagtccccagtgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcagtttcttcaaccatcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgttggtgttgtctca
atatcaataatactcttattattactcgggcttttcctgtggctgaaaaggagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatggatca
tgcagacaagtgcagtatcctctgacggacctatcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaataccgtccacattgacctcagtgctctaaatcca
gagctggtgcaggcagtccagcacgtagtgattgggcctagtagtctgattgtgcatttc
aatgaagtcataggaagaggacattttgggtgtgtatatcatgggactttgttggacaat
gatgacaagaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccagtttctcaccgagggaattatcatgaaagattttagtcatcccaacgttctc
tcgctcttgggaatctgccttcgaagtgagggatctccactggtggttctaccgtacatg
aaacatggagaccttcgaaatttcattagaaatgagacccacaacccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaaggtt
gctgattttgggcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaa
acaggtgcaaaactgcctgtgaagtggatggctttagagagtctgcaaactcagaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gcaccaccttatcccgatgtcaacacctttgatataacagtttacttgttgcaaggcaga
aggctcttacaaccagagtactgcccagatcccttgtatgaagtgatgctaaaatgctgg
caccctaaagctgaactgcgcccatccttttctgaactggtctccaggatatcagcgata
ttctctactttcatcggggagcactacgtccatgtgaacgctacttatgtgaatgtgaaa
tgtgttgctccatatccttctctgttgtcatcacaagataacgttgatggcgaggtagat
acatga

KEGG   Equus caballus (horse): 100057614
Entry
100057614         CDS       T01058                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04520  Adherens junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04714  Thermogenesis
ecb04810  Regulation of actin cytoskeleton
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05224  Breast cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100057614 (FGFR1)
   04014 Ras signaling pathway
    100057614 (FGFR1)
   04015 Rap1 signaling pathway
    100057614 (FGFR1)
   04020 Calcium signaling pathway
    100057614 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100057614 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100057614 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100057614 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100057614 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100057614 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100057614 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057614 (FGFR1)
   05205 Proteoglycans in cancer
    100057614 (FGFR1)
   05230 Central carbon metabolism in cancer
    100057614 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100057614 (FGFR1)
   05215 Prostate cancer
    100057614 (FGFR1)
   05224 Breast cancer
    100057614 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100057614 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100057614 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:ecb00536]
    100057614 (FGFR1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100057614 (FGFR1)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100057614 (FGFR1)
CD molecules [BR:ecb04090]
 Proteins
  100057614 (FGFR1)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100057614 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 100057614
NCBI-ProteinID: XP_023486323
Ensembl: ENSECAG00000015006
VGNC: 18022
LinkDB
Position
27
AA seq 822 aa
MWSWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcacc
gccaggccggccccaactttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccctggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtccagagcatcaactggctgcgggacggggtacagctggtggaaagcaaccgtacccgc
atcacgggggaggaggtggaggtgcgggattccgtgcccgctgactccggcctctacgct
tgcgtgaccagcagcccctcaggcagcgacaccacctacttctccgtcaatgtctcagat
gctctcccttcctcggaggacgacgatgatgatgatgactcctcttcagaggagaaggag
acagataacaccaaaccaaaccgtatgcccgtggctccatattggacgtccccggaaaag
atggaaaagaaattgcatgcagtgccagctgctaagacagtgaagttcaagtgcccttcc
agtgggactcctaaccctacactgcgctggctgaaaaatggcaaagaattcaaacctgac
cacaggatcggaggctacaaggtccgttatgccacgtggagcatcataatggactcggtg
gtgccctctgacaagggcaactatacctgcatcgtggagaacgagtatggcagcattaac
cacacctaccagctcgacgtcgtggagcggtctcctcaccggcccatcctgcaggcaggg
ttgcctgccaacaagacagtggccctgggcagtaatgtggagttcatgtgtaaggtgtac
agtgacccacagccccacatccagtggctaaagcacatcgaggtgaatgggagtaagatt
ggcccggacaaccttccgtatgtccagatcttgaagactgccggagttaataccaccgac
aaagagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagacccgcggtgatgacctcgcccctgtacctggagatcatcatctat
tgcacgggggccttcctcatctcctgcatggtgggctctgtcatcatctacaagatgaag
agtggcaccaagaagagtgacttccacagccagatggccgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcagccgactccagcgcgtccatgaactctggg
gttctgctggttcggccctcacgtctctcctccagtggaacccccatgctggctggggtc
tctgaatatgagcttcctgaagaccctcgctgggagctgcctcgagacagactggtttta
ggcaaacccctgggagagggctgctttgggcaggtggtgctggcggaggccattgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggctgtgaagatgctgaaatcggatgca
accgagaaagacctgtcagacctgatctcagaaatggagatgatgaagatgatcgggaag
cacaagaacatcatcaacctgctgggggcctgcacgcaggatggtcctttgtatgtcatc
gtggagtatgcctccaagggcaacctacgggagtacctgcaggcccggaggcctcctggg
ctggaatactgttacaaccccagccacaaccccgaagagcagctctcctccaaggacctg
gtatcctgtgcctatcaggtggcccgaggcatggaatatcttgcctctaagaagtgcata
caccgagacctggccgcgaggaatgtcctggtgacagaggacaatgtgatgaagatcgca
gattttggcctagctcgggacattcaccacatcgactactataaaaagacaaccaatggc
cgactgcctgtgaagtggatggcacccgaggcattgtttgaccggatctacacccaccag
agtgatgtatggtcttttggggtgctcctgtgggaaatcttcactctgggtggctcccca
tatcctggcgtgcctgtggaggagcttttcaagctgctgaaggaaggtcatcgaatggac
aagcccagtaactgcaccaacgagctgtacatgatgatgcgggattgttggcatgcagta
ccctctcagagacctaccttcaagcagctggtggaagacctggaccgcattgtggccttg
acctccaaccaggagtatctggacctgtcaatgcccctggaccaatactctcccagcttt
cctgacacccgaagctctacctgttcctcaggggaggattccgttttctctcatgagccg
ttgcctgaggagccctgtctgccccgacacccagcccagcttgccaatggcggactcaaa
cgacgctga

KEGG   Equus caballus (horse): 100059815
Entry
100059815         CDS       T01058                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100059815 (PDGFRA)
   04014 Ras signaling pathway
    100059815 (PDGFRA)
   04015 Rap1 signaling pathway
    100059815 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100059815 (PDGFRA)
   04020 Calcium signaling pathway
    100059815 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100059815 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100059815 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100059815 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100059815 (PDGFRA)
   04540 Gap junction
    100059815 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100059815 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059815 (PDGFRA)
   05206 MicroRNAs in cancer
    100059815 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100059815 (PDGFRA)
   05231 Choline metabolism in cancer
    100059815 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100059815 (PDGFRA)
   05218 Melanoma
    100059815 (PDGFRA)
   05215 Prostate cancer
    100059815 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100059815 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100059815 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100059815 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100059815 (PDGFRA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100059815 (PDGFRA)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100059815 (PDGFRA)
CD molecules [BR:ecb04090]
 Proteins
  100059815 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 100059815
NCBI-ProteinID: XP_001492327
Ensembl: ENSECAG00000018176
VGNC: 21261
UniProt: F7A2X2
LinkDB
Position
3
AA seq 1089 aa
MGTCHRALLVLGCLLTGPSLSFCQLSLPSILPNEDEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQTEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVLASYDSRQGFNG
TFSVGPYICEATVKGKKFRTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLSVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPNFSRLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLTPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttgccatcgggcactcctggtcttaggctgtctcctcacagggcccagccta
agcttctgccagctttcattaccctccatcctcccaaatgaagatgaaaaggttgtgcag
ctgaactcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
atgtctgaagaagagaaccctaacgtggaaatcagaaatgaggaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcagcagcccacacgggattgtacacttgc
tattacaaccacacgcagacagaagaaagcgagatcgaaggcaggcgcatttacatctat
gtgccagaccctgatgtggccttcgtacctctaggaatgacagactatttagtcatcgtg
gaggatgatgattctgccatcatcccttgtcgcacgactgatcctgagactccagtgacc
ttactcagcagtgacggggtggtactcgcctcctacgacagcagacagggctttaacgga
accttcagcgtcgggccctacatctgcgaggccaccgtcaaagggaagaagtttcggacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagagatggaagct
cttaagactgtgtataagtcgggggaaacgattgtggtcacctgtgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtacaccctgagcgtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggccaccagggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaaggcttcattgaaatcaaacccaac
ttcagccggctggaagccgttgacctgcatgaggtcaaacattttgtggtggatgtgcag
gcctacccgcctcctaggatatcctggctgaaggacaacctgactctgatcgaaaatctc
actgagatcaccactgacatagaaaagatccaggaaataaggtaccgaagcaaattaaag
ctgatccgtgcaaaggaagaagacagtggtcattatactattgtagttcaaaatgaagat
gatgtaaagagctatacctttgaactcttaactcaagttccctcatctattctggacttg
gtcgacgaccaccatggctctaccgggggtcagactgtgagatgcacagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcgtggacgattttggctaacaacatctcaaacatcatcacggaggtccacccccgagac
aggagtactgtggagggccgagtgacgtttgccaaagtggaggagaccattgccgttcgg
tgtctggctaagaatctccttggggctgagaaccgagagctgaagctggtggctcccact
ctacgttctgaactcacagtggcagctgcggtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaagcagaaaccgaggtacgaaattcgttggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggcctcgtgcttggtcgtatcctggga
tctggtgcgtttgggaaagtggtcgaaggaactgcttatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggcccaatttacatcatcacagagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgacccctgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgctggagaggaaagaggtttctaaatattcggacatccagaggtcg
ctgtatgatcgcccagcctcatataagaagaaagctatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggcctaactttgctggatttgttgagcttcacttat
caagttgcccgaggaatggagtttttggcttcaaagaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattccaactacgtgtccaaaggcagcacctttctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagg
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagattcacctggacttcctgaagagcgatcatcccgccgtggcacgcatg
cgcgtggactctgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggttgagtgcggacagtggctacatcatc
cctctgccggacatcgaccctgttccggaggaggaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctaccttcatt
aagagagaggatgagaccattgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

KEGG   Equus caballus (horse): 100067755
Entry
100067755         CDS       T01058                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb05160  Hepatitis C
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100067755 (EGFR)
   04012 ErbB signaling pathway
    100067755 (EGFR)
   04014 Ras signaling pathway
    100067755 (EGFR)
   04015 Rap1 signaling pathway
    100067755 (EGFR)
   04630 JAK-STAT signaling pathway
    100067755 (EGFR)
   04066 HIF-1 signaling pathway
    100067755 (EGFR)
   04068 FoxO signaling pathway
    100067755 (EGFR)
   04020 Calcium signaling pathway
    100067755 (EGFR)
   04072 Phospholipase D signaling pathway
    100067755 (EGFR)
   04151 PI3K-Akt signaling pathway
    100067755 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100067755 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100067755 (EGFR)
   04520 Adherens junction
    100067755 (EGFR)
   04540 Gap junction
    100067755 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100067755 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100067755 (EGFR)
   04915 Estrogen signaling pathway
    100067755 (EGFR)
   04921 Oxytocin signaling pathway
    100067755 (EGFR)
   04926 Relaxin signaling pathway
    100067755 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100067755 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067755 (EGFR)
   05206 MicroRNAs in cancer
    100067755 (EGFR)
   05205 Proteoglycans in cancer
    100067755 (EGFR)
   05230 Central carbon metabolism in cancer
    100067755 (EGFR)
   05231 Choline metabolism in cancer
    100067755 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100067755 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100067755 (EGFR)
   05212 Pancreatic cancer
    100067755 (EGFR)
   05225 Hepatocellular carcinoma
    100067755 (EGFR)
   05226 Gastric cancer
    100067755 (EGFR)
   05214 Glioma
    100067755 (EGFR)
   05218 Melanoma
    100067755 (EGFR)
   05219 Bladder cancer
    100067755 (EGFR)
   05215 Prostate cancer
    100067755 (EGFR)
   05213 Endometrial cancer
    100067755 (EGFR)
   05224 Breast cancer
    100067755 (EGFR)
   05223 Non-small cell lung cancer
    100067755 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100067755 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100067755 (EGFR)
   05171 Coronavirus disease - COVID-19
    100067755 (EGFR)
   05163 Human cytomegalovirus infection
    100067755 (EGFR)
   05165 Human papillomavirus infection
    100067755 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100067755 (EGFR)
   01522 Endocrine resistance
    100067755 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100067755 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100067755 (EGFR)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100067755 (EGFR)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100067755 (EGFR)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100067755 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100067755 (EGFR)
  Exosomal proteins of bladder cancer cells
   100067755 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100067755
NCBI-ProteinID: XP_023494835
Ensembl: ENSECAG00000009952
VGNC: 17460
LinkDB
Position
4
AA seq 1209 aa
MRHSGTVGAALLVLLAAYFQASPALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALS
VLSNYGANKVGLRELPMRNLQEILQGAVRFSNNPILCNMETIQWRDIVNSDFLSNMSVDF
QNQLGSCQKCDPACPNGSCWGVGKENCQKLTKTICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILQTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYANTIKWKKL
FGTSSQKTKIINNRSEKDCKTVGHVCNLLCSSEGCWGPEPRDCVSCQNVSRGKECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIKCAHYIDGPHCVKTCPSGIM
GENNTLVWKFADANHVCHLCHPNCTYGCAGPGLEGCARNGPKIPSIATGIVGGLLLVVVV
ALGIGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRTLMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLISSLSATSNNSTVACIDRNGQSCPLKEDSFLQRYSSDPTGTVTEDN
IDDTFLPAPEYVNQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAMDNPEYLNT
THPDCVNSVLDGTALWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENAEYLRVA
PPSSEFIGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacattcagggaccgtcggcgccgcgctcctggtgctgctggctgcgtacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggcacaagtaacaggctcacgcag
ttgggcacttttgaggaccactttctgagcctccagagaatgttcaataactgtgaggtg
gtcctcgggaatttggaaattacctacatgcaaaagaattatgacctttccttcttaaag
accatacaggaggttgctggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaatctgcagatcatcagaggaaatgtgctgtatgaaaacacccatgccttatca
gtcttatccaactatggtgcaaataaagtcggactgagggagcttcctatgaggaactta
caggaaatcctgcagggtgctgtacgattcagcaacaaccctatcctctgcaacatggag
actatccagtggcgggacattgtcaacagtgattttctaagcaatatgtcagtggacttt
cagaatcaactgggcagttgccaaaagtgtgatccagcctgccccaatggaagctgttgg
ggtgtgggaaaggagaactgccagaaattgaccaagaccatctgtgcccagcagtgttca
gggcgctgccgtggcaggtcccccagcgactgctgccacaaccagtgtgccgccggctgc
acagggccccgggagagtgactgcctggtctgccgaaaattccgggatgaagccacgtgc
aaggacacctgcccaccactcatgctttacaaccccaccacgtaccagatggacgtcaac
ccagatggaaaatacagcttcggtgccacctgtgtgaagaaatgcccccgtaactatgtg
gtgacagaccacggttcctgtgtccgcgcctgcagttctgacagctacgaggtggaggaa
gacggagtccgcaaatgtaaaaagtgtgaagggccttgtcgcaaagtttgtaatggaata
ggaattggtgaatttaaagacacactttccataaatgctaccaatattaaacacttcaaa
aattgtacctcgatcagtggagatcttcatatcctgccggtagcatttaggggtgactcc
ttcacacggaccccgcctctggatcccaaggagctggatattctacaaacggtgaaggag
ataacagggtttttgctgattcaggcctggccagaaaacaggactgacctccatgctttc
gagaacctggaaatcatacgtggcagaaccaagcaacatggtcagttttctcttgcggtc
gtcggcctggacattacatctttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcagggaaccgaaacttatgttatgcaaatacaataaaatggaaaaaactg
tttgggacctcaagtcagaaaaccaaaattataaacaacagaagtgaaaaagactgcaag
accgttggccatgtctgtaatctgttatgctcgtcagagggctgctggggcccagagccc
agagactgcgtgtcctgccagaacgtcagccgtggcaaagaatgtgtagagaagtgcaac
attctggaaggcgagccaagggagtttgtggagaattccgagtgcatacagtgccatcca
gaatgcctgccccaggccatgaatataacctgcacaggacgtggcccagacaactgcata
aagtgtgctcactacatcgatggccctcactgtgtcaagacctgcccgtctggaatcatg
ggagaaaacaataccctggtctggaagtttgcggatgccaatcacgtgtgtcacctgtgc
catccaaactgtacctacggctgtgctgggccaggcctcgaaggctgtgcaagaaatggg
cccaagatcccatccatcgctactgggattgtgggcggcctcctcctggtggtggtggta
gcccttgggattggcctctttttgcgcaggcggcacatcgtccggaagcgcactctgcgc
agactcctgcaggaaagagagctcgtcgagcctcttacacccagcggagaagctccgaac
caagctctcttgaggatcttaaaggaaaccgaattcaaaaagatcaaggtgctaggttct
ggagcattcggcacagtgtacaaggggctctggatcccagaaggtgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacgtctccaaaagccaacaaggaaattctt
gatgaagcctatgtgatggccagtgtggacaaccctcacgtgtgtcgccttctgggcatc
tgcctgacctccacagtccagctcatcacgcagctcatgcctttcggctgcctcctggac
tatgtccgtgagcacaaggacaacattggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagcc
aggaacgtcctggtgaaaacaccacagcatgtcaagatcacagattttgggctggccaaa
ctgcttggtgcggaggaaaaagaataccacgcagaaggaggcaaagtacctatcaagtgg
atggctttagaatcaattttgcaccgaatttatacccaccaaagtgatgtctggagctat
ggagtcaccgtttgggaactgatgacctttgggtccaagccttatgacggaattcccgca
agtgagatctcaaccatcctggagaaaggggagcgcctcccgcagccgcccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagatgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggccagagacccccagcgctaccttgtc
atccagggggatgagagaatgcatttgccaagccctacagactccaacttttatcgcacc
ctgatggatgaagaggacatggaagatgtcgttgatgccgatgagtacctcatcccacag
cagggcttcttccacagtccctccacatcccggacacccctcataagttctctgagtgcc
accagcaataattccactgtggcttgcattgatagaaacgggcagagctgtcccctcaag
gaagacagcttcttgcagcggtacagctcagaccccactggcaccgtgactgaggacaac
atagatgacactttcctcccggcgcctgagtacgtaaaccaatccgttcccaaaaggccc
gcaggttctgtccagaaccctgtctatcacaatcagcctctaaatccagctcctggcaga
gatcctcactatcaaaatccccacagcaatgcgatggacaaccctgagtacctcaacacc
acccatcctgactgcgtcaacagtgtgctcgatggtactgccctctgggcacagaaaggc
aatcaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaagcc
aagtcaaatggcatctttaagggtcctgcagctgaaaatgcagaatacctaagggtagca
ccaccaagcagtgaatttattggagcatga

KEGG   Equus caballus (horse): 100071665
Entry
100071665         CDS       T01058                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X2
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100071665 (PDGFRB)
   04014 Ras signaling pathway
    100071665 (PDGFRB)
   04015 Rap1 signaling pathway
    100071665 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100071665 (PDGFRB)
   04020 Calcium signaling pathway
    100071665 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100071665 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100071665 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100071665 (PDGFRB)
   04540 Gap junction
    100071665 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100071665 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100071665 (PDGFRB)
   05206 MicroRNAs in cancer
    100071665 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100071665 (PDGFRB)
   05231 Choline metabolism in cancer
    100071665 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100071665 (PDGFRB)
   05218 Melanoma
    100071665 (PDGFRB)
   05215 Prostate cancer
    100071665 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100071665 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100071665 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100071665 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100071665 (PDGFRB)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100071665 (PDGFRB)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100071665 (PDGFRB)
CD molecules [BR:ecb04090]
 Proteins
  100071665 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 100071665
NCBI-ProteinID: XP_014586066
Ensembl: ENSECAG00000024793
VGNC: 21262
LinkDB
Position
14
AA seq 1106 aa
MWLLSTTTAPVLKGQVLLLPLLLLLGPRASRGLVITPPGPELVLNISSTFVLTCSGPAPV
VWERLSQEPLQETAKTQDGTFSSMLTLTNVTGLDTGEYFCAYKGSHGLEPGERKRIYIFV
PDPTVGFLPVDPEELFIFLTEITETTIPCRVTDPQLVVTLHEKKVDVPLPIPYDHQRGFS
GTFEDKTYVCKTTIGDREVDSEAYYIYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFDMPSHIRSILHIPSAELGDSGTYICNVSESVNDH
RDEKAINVTVVESGYLRLLGELDPVQFAELHRSRTLQVVFEAYPPPTVVWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEAQLSFQLQVNVPVRVL
ELSESHPASGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEESQLETNV
TYWAEEQEFEVVSTLRLRRVDRPLSVRCTLRNLLGHDVQEVTVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHCSEKRRPPSTELYSNAL
PVGLPLLSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINDSPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLQSPLDASSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPVEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEAQPEPQV
QPELEPEWPLDSSCPGPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgtggcttctgagtaccacgacagctccggtcctcaaaggccaggtgctgctgctgccc
ctgctgttgctgctgggaccacgggcctcccggggcctggtcatcacgcccccggggcca
gagcttgtcctcaatatctccagtaccttcgtgctcacctgctcgggtccagctccagtg
gtatgggaacggttatcccaagagcccctgcaggaaacggccaagacccaggacggcacc
ttctccagcatgctgacgctgaccaatgtcactgggctagacacaggagaatatttctgt
gcctacaaaggctcccatgggctggagcctggtgagcgaaaacggatctacatctttgtg
ccagatcccactgtgggcttcctccccgtcgaccccgaggaactattcatctttctcacg
gaaataactgagaccacaattccatgccgagtgacggatccacaactggtggtgacactg
catgagaagaaagtggatgtcccgctgcccatcccctatgaccaccaacgtggcttctct
ggtacctttgaggacaagacctatgtctgcaaaaccaccatcggggacagggaggtggat
tcggaagcttactacatctacagcctccaggtgtcatccatcaatgtctcagtgaatgca
gtgcagactgtggtacgccagggtgagaacatcaccatcatgtgcattgtgactgggaac
gaggtggtcaactttgagtggacatacccacgcatggagagtgggcggttggtggagcca
gtgactgacttcctcttcgatatgccctcccacatacgctccatcctgcacatccccagt
gccgagctgggtgactcagggacctatatctgcaatgtatcagagagtgtgaatgaccat
cgtgatgaaaaagccatcaatgtcactgtggttgagagcggctacctgcggctgctggga
gagctggaccctgtacaattcgcggagctgcaccgcagccggacactgcaggtggtgttc
gaggcctacccgccacccactgtcgtgtggttcaaggacaaccgcacgctgggcgactcc
agcgccggcgagatcgccctgtccacgcgcaatgtgtccgagacccggtacgtgtcagaa
ctgacactggtgcgggtgaaggtggctgaggctggccactacaccatgcgggccttccat
gaggacgctgaggcccagctctccttccagctgcaggtcaacgtccctgtccgcgtgctg
gagctgagcgagagccatcccgccagcggggagcagacagtccgctgtcgcggccggggc
atgccacagccgcacctcacctggtccacttgcagcgacctcaaaaggtgtccgcgcgag
ctgccgcccacgccgctggggaacagttctgaggaggagagccagctggagaccaacgtg
acgtattgggcggaggagcaggagttcgaggtggtgagcacgctgcgcctgcgccgcgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacttgctgggccatgatgtgcaagag
gtcactgtggtgccacattctctgcccttcaaggtggtggtgatctcggccatcctggcc
ttggtggtcctcacgatcatctccctcatcatcctcatcatgctctggcagaagaagcca
cgttatgagatccgatggaaggtgattgaatctgtgagctctgatggccatgagtacatc
tacgtggacccgatgcagctgccctacgactccacctgggagctgcctcgggaccagctt
gtgcttggacgcacgcttggctccggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattcacaagccacgatgaaagtggccgtcaagatgctgaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcacctcgggccc
catctgaatgtggtcaacctgctgggggcctgcaccaaaggaggacccatctacatcatc
accgaatactgccgctacggcgacctggtggactacctgcaccgcaacaagcacacgttc
ctgcagcactgctccgagaagcgccggccgcccagcaccgagctctacagcaatgccctg
cccgtcggcctccccctgctcagccacatgtccctgcctggggagagtgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaactacatggccccttacgataactacgtcccc
tctgcccccgagaggacctgccgggcgactttgatcaacgactccccagtgctcagctac
accgaccttgtgggcttcagctatcaggtggccaatggcatggagttcctggcctccaag
aattgcgtccaccgagacctggcagccaggaacgtgctcatctgtgagggcaagctggtc
aagatctgtgactttggcctggctcgtgacatcatgcgggactcgaactacatctccaaa
ggcagtaccttcctgcctttgaagtggatggcccccgagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcttactctgggagatcttcaccctgggt
ggcaccccttacccagagctgcccatgaacgagcagttctacaatgccatcaagcggggc
taccgcatggcccagcctgcccacgcctccgacgagatctacgagatcatgcagaagtgc
tgggaagagaagtttgagattcggcctcccttctcccagctggtgctgcttctcgagaga
ctgctgggtgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagc
gaccacccagccatccttcggtcccaagcccgcttgcccggcttccatggtctccaatca
cccctggacgccagctccgtcctctacactgctgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcccgaccccaaacccgaggttgctgatgagggcccagtggagggt
tcccccagccttgccagctccaccctgaatgaagtcaacacctcctctaccatctcctgt
gacagccccctggaaccacaagaggaaccagagccagaggcccagcccgagccccaggtg
cagccggagctggagccagagtggccgctggattcaagctgccccgggcctcgggccgag
gcggaggacagcttcctgtag

DBGET integrated database retrieval system