KEGG   Equus caballus (horse): 100055743
Entry
100055743         CDS       T01058                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X3
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00310  Lysine degradation
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100055743 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100055743 (KMT5C)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     100055743 (KMT5C)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100055743 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 100055743
NCBI-ProteinID: XP_005596601
Ensembl: ENSECAG00000013820
VGNC: 19497
LinkDB
Position
10
AA seq 576 aa
MGGRGGSGGAGPAGQTGGVATVSDESRRRQWEVVAAAARAPEEEVEEEEKRMRRRKGTPK
SRLSYKWPRASTCPGFRPCFAPATLGQRQHGPWGSMGPDRVTARELCENDDLATSLVLDP
YLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRDLEAAYRALTLGGWMAHYFQSRGPRQ
EAALKTHIYRYLRAFLPESGFTILPCTRYSMEKNGAKIVSTRAWKKNEKLELLVGCIAEL
READEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKEVVRTCLLCGCEDEF
VPADGNAACVKVLRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERKGEGAFRLRPREPVP
PRPLDKYELRETKRRLQQGLDSSGRQGLLGPRACAHLSLLRRDPFCAACQPLRPQPCGSR
LDAVPLWLQWLPQPQLRVRPRRRRRPQPRRALAPPVLRTARVSLHRWGGCGPRCCLRAEA
LVALGQGPRARWAPQQDWHWARRYGLPYVARVDLSRMAPAPPATTVPAPVRTPGPSPGSG
PIPKQALAFAPFSPPKRLRLVVSHGSINLDVNGDRP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgggaggccggggtggcagtggcggggctggcccggcagggcagacgggaggggtggcg
acggtgtctgacgagagccggaggaggcagtgggaggtggtggcggcggcggcgcgggcg
cctgaggaggaggtggaggaggaggagaagcggatgaggagacggaagggcacgccaaag
tcccgcttgtcttataagtggcccagagcaagcacctgcccagggttccgcccctgcttt
gcacccgccactctgggccagaggcagcatggtccgtggggcagcatggggcccgacaga
gtgacagccagagaactgtgtgagaacgacgacctggccaccagcctcgtcctggacccc
tacctcggcttccgcacccataagatgaatgtcagccccgtgccccccctgcggcgacag
caccacctgcgctcagcgctggaggccttcctgaggcagcgggacctggaggctgcgtac
cgggccctgacgctgggaggctggatggcccactacttccagagccggggcccacggcag
gaggctgccctcaagacccacatctatcgctacctccgcgccttcctgcctgaaagcggc
tttaccatcctgccctgtacccgctattccatggagaaaaatggagccaagatcgtgtct
acccgagcttggaagaagaatgagaagctggagctgctggtgggctgcatcgcggagctg
cgggaggccgacgaggggctgctgagggccggcgagaacgacttcagcatcatgtactcg
acccgcaagcgcagcgcccagctgtggctcggccctgccgccttcatcaaccacgactgc
aaacccaactgcaaggaggtggtgagaacttgcctcctgtgcggttgtgaagatgagttt
gtgcccgcagatgggaatgcagcctgcgtgaaggtgctccgggacatcgagccaggggac
gaggtgacctgcttctacggtgacggcttctttggtgaaaagaatgagcactgtgaatgc
tacacctgcgagaggaaaggcgaaggagctttccgactgcggccccgggagcctgtgcct
ccgcgacccctggacaagtacgagctccgggagaccaagcggcggctgcagcaaggcctg
gacagcagtggccggcagggcctgctgggcccacgcgcctgcgcccacctgtctctgctg
cgccgggaccccttctgcgccgcctgtcagcccctgcgcccccagccctgcggctcccgc
ctggacgccgtgcccctctggctccagtggctgcctcagccacagctccgagtgcgcccc
cggaggcgccgacgcccccagccccggcgggccctggcaccccctgttctccgcactgcc
cgtgtctccctgcaccggtggggaggctgcggcccccgctgttgcctccgggcggaagcc
ctggtggccctgggccaaggcccccgtgcccgttgggccccccagcaggactggcactgg
gcccggcgctacgggctgccttatgtggcgcgcgtggacctgagccgcatggccccggcc
ccacctgccactactgtccccgcccctgtcaggaccccaggccccagccccggctccggc
cccatccccaagcaagcccttgccttcgctcccttctccccacccaagcgcctgcggctg
gtggtcagccacggctccatcaacctggatgtcaatggtgacaggccatga

DBGET integrated database retrieval system