KEGG   Equus caballus (horse): 100056013
Entry
100056013         CDS       T01058                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04360  Axon guidance
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb05100  Bacterial invasion of epithelial cells
ecb05144  Malaria
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05218  Melanoma
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100056013 (MET)
   04014 Ras signaling pathway
    100056013 (MET)
   04015 Rap1 signaling pathway
    100056013 (MET)
   04020 Calcium signaling pathway
    100056013 (MET)
   04151 PI3K-Akt signaling pathway
    100056013 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100056013 (MET)
   04520 Adherens junction
    100056013 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100056013 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056013 (MET)
   05202 Transcriptional misregulation in cancer
    100056013 (MET)
   05206 MicroRNAs in cancer
    100056013 (MET)
   05205 Proteoglycans in cancer
    100056013 (MET)
   05230 Central carbon metabolism in cancer
    100056013 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100056013 (MET)
   05226 Gastric cancer
    100056013 (MET)
   05218 Melanoma
    100056013 (MET)
   05211 Renal cell carcinoma
    100056013 (MET)
   05223 Non-small cell lung cancer
    100056013 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100056013 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100056013 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100056013 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100056013 (MET)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100056013 (MET)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100056013 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like Ninjurin
Other DBs
NCBI-GeneID: 100056013
NCBI-ProteinID: NP_001107619
Ensembl: ENSECAG00000010385
VGNC: 20111
UniProt: Q2QLA9
LinkDB
Position
4
AA seq 1381 aa
MKAPAVLAPGILVLLFTLVQKSDGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGATNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSRKANLSGGAWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPLNNVADIQSEVYCMYSPQAEEPHQCPDCVVSAL
GTKVLLSEKDRFVTFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLPE
FRDSYPIKYIHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECIL
TEKRRKRSTSEEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQSKPDSAEPMNRS
AVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPHHEHCFNRTLLRNSSGCEVRNDEYRTEF
TTALQRVDLFMGQFNQVLLTSISTFIKGNLTIANLGTSEGRFMQVVVSRSGSSTPHVNFH
LDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCGW
CHDKCVRLEECHNGTWTQEICLPTIYKVFPTSAPLEGGTTLTVCGWDFGFRKNNKLDSKK
TKVLLGNESCTLTLSESTSNTLKCTVGPAMNERFNISITVSNSRGTARYSTFSYVDPIIT
SISPSYGPKTGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTEF
PVKLKIDLANREMNSFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVLRMVINVR
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNPV
FKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPSDL
LKLNSELNIEWKQAVSSTILGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKRRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEVD
T
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgaaggcacctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcgatggggagtgtaaagaggcgctagtaaagtccgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaacgtcgttttacacaagcat
cacatttacctcggggccactaactacatttatgttttaaatgacaaagatcttcagaaa
gttgctgagtacaagactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccgcaaagccaatttatcaggtggcgcttggaaagataacatcaacatggctctg
cttgttgacacatactatgacgatcaactcattagttgcggcagcgtccacagagggacc
tgccagcggcacgtccttccactcaacaatgttgctgacatacagtcagaagtttattgc
atgtactctccacaagcagaagagccccaccagtgtcctgactgtgtggtgagtgccctg
ggaaccaaagtcctgctgtctgaaaaggaccgatttgtcaccttcttcgtgggcaatacc
ataaattcttcttaccttccagatcattcattgcattcgatatcggtgagaaggctaaag
gaaacgcaagatggttttaagtttttgacagatcagtcctatattgatgttctacctgag
ttccgagattcttaccccattaagtatatccacgcctttgaaagcaaccattttatttac
tttttaacggtccaacgggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccgtggactctggattgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaagaaagagatccacaagtgaggaagtgtttaatatcctccaagctgcg
tatgtcagtaagcctggggctcatcttgctaagcaaataggtgccaacctgaatgatgac
attctctatggggtgtttgcacagagcaagccagattctgctgaaccaatgaatcgctct
gccgtctgtgcattccctgtcaaatatgtcaatgaattcttcaacaagattgtcaacaaa
aacaacgtgagatgtctccagcatttttatggaccccaccatgaacactgcttcaatagg
acacttttgagaaattcatcaggctgtgaagtgcgcaatgatgaatatcgaacggagttt
accacagctttgcagcgcgttgacttgttcatgggccaattcaaccaagtcctcttgaca
tctatatccaccttcattaaaggaaacctcactatagctaatcttgggacatcagaaggt
cgcttcatgcaggttgtggtttctcgatcaggatcgtcaacccctcatgtgaattttcac
ctggattcccaccctgtgtctccagaagtgattgtggaacacccattaaaccaaaatggt
tacacactggttgtcaccgggaaaaagatcaccaagatcccactgaatggcttgggctgt
gaacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcagtgtggctgg
tgccacgacaaatgtgtgcgattggaggaatgccacaacggaacatggactcaagagatc
tgtctgcctacaatctacaaggttttcccaaccagtgcccccctcgaaggagggacaacg
ctgacagtatgtggctgggactttggattcaggaagaataataaacttgattcaaagaaa
accaaagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgtcaaat
acgttgaaatgcacagttggtcctgcaatgaatgagcgtttcaatatatccataactgtt
tccaacagtcgagggacagcacgatatagtacattttcctatgtggatcctataataaca
agtatttctccaagttatggtcctaagactggtggcactttacttactttaactggaaag
tacttaaacagtgggaattctagacacatttcaattggtggaaaaacatgtaccttaaaa
agtgtgtcagatagtattcttgaatgttatactccagcccaaaccactccaactgagttt
cccgttaaactgaaaattgacttagccaaccgagagatgaacagcttcagttaccgggaa
gaccccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaatt
acaggtgttggaaaaaatctgaattcggttagtgtcctgaggatggtgataaatgtgcgt
gaagcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgc
tgtacaactccttcactacaacagctgaatttgcaactccctctgaaaaccaaagccttc
ttcatgttggacgggatccattccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagccgttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacactcacattctgaagccgttttatgtacagtccccagtgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcagtttcttcaaccatcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgttggtgttgtctca
atatcaataatactcttattattactcgggcttttcctgtggctgaaaaggagaaagcaa
attaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatggatca
tgcagacaagtgcagtatcctctgacggacctatcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaataccgtccacattgacctcagtgctctaaatcca
gagctggtgcaggcagtccagcacgtagtgattgggcctagtagtctgattgtgcatttc
aatgaagtcataggaagaggacattttgggtgtgtatatcatgggactttgttggacaat
gatgacaagaaaattcactgtgctgtgaaatccttgaatagaatcactgacataggagaa
gtttcccagtttctcaccgagggaattatcatgaaagattttagtcatcccaacgttctc
tcgctcttgggaatctgccttcgaagtgagggatctccactggtggttctaccgtacatg
aaacatggagaccttcgaaatttcattagaaatgagacccacaacccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaaggtt
gctgattttgggcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaa
acaggtgcaaaactgcctgtgaagtggatggctttagagagtctgcaaactcagaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gcaccaccttatcccgatgtcaacacctttgatataacagtttacttgttgcaaggcaga
aggctcttacaaccagagtactgcccagatcccttgtatgaagtgatgctaaaatgctgg
caccctaaagctgaactgcgcccatccttttctgaactggtctccaggatatcagcgata
ttctctactttcatcggggagcactacgtccatgtgaacgctacttatgtgaatgtgaaa
tgtgttgctccatatccttctctgttgtcatcacaagataacgttgatggcgaggtagat
acatga

DBGET integrated database retrieval system