KEGG   Equus caballus (horse): 100056166Help
Entry
100056166         CDS       T01058                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ecb  Equus caballus (horse)
Pathway
ecb00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ecb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100056166 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100056166
NCBI-ProteinID: XP_001503310
Ensembl: ENSECAG00000007294
VGNC: 21434
UniProt: F7DLU4
LinkDB All DBs
Position
22
AA seq 578 aa AA seqDB search
MAVAVRLALIVLLLLGPGGWGHTEPSRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLISKYSLQELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVIPTASFKPLGLANGTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLAAESRVYVDITSSKQDNETLEVNPPP
LTTYQDVILGTQKTYAVYDLLDTAVINNSRNLNLQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQSGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSIVA
SKPVDWEESPLFNSLFPGSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPSKGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccgtgcggctggcactgattgtactgctgctcctgggaccaggcggctgg
ggccatacagagccctcacgcgacagcctgcgggaggagctggtcatcaccccgctgcct
tctggggacgtagccgccacgttccagttccgcacgcgctgggattcggagctgcaacgg
gaagaagtgtctcattataggctcttccccaaagccctggggcagttgatctccaagtat
tctctgcaggagctgcacctgtcattcactcaaggcttctggaggactcgatactgggga
ccacccttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacaccgtc
actgatgtggataaatcttggaaggagctcagtaacgtcctctcagggatcttctgtgcc
tctctcaacttcatcgactccaccaacacggtcattcccactgcctccttcaaacccctg
gggctggccaatggcactgatcactatttcctgcgctatgccgtgctgccgcgggaggtt
gtctgcactgagaaccttaccccatggaagaagctcttgccctgtagttccaaggcaggc
ctctctgtgctgctgaaggctgatcgcttgttccacactagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtaccagcatctcctgggagctgaggcag
accctttccgttgtgtttgatgccttcgtcacggggcaagggaagaaagactggtccctc
ttccggatgttctcccggaccctcacagagccctgccccctggctgcagagagccgagtc
tatgtggacatcaccagctctaagcaggacaatgagacgttggaggtgaacccgccccct
ctcaccacataccaggatgtcatcctgggcacccagaagacctatgctgtctacgattta
cttgacacggccgtgatcaacaactcccgcaaccttaacctccagctcaagtggaagaga
cccccagagaatgaggccccaccagtgcccttcctgcacgcccagcggtacgtgagcggc
tatgggctgcagagtggggagctgagcaccctgctgtacaacacccacccctaccgggcc
ttccctgtgctgctgctggacacggtgccctggtacctgcggctgtatgtgcacaccctc
accatcacctccaagggcaaggagaacaagccaagttacatccactaccagcctgcccag
gaccggctgcagcctcacctcctggagatgctgattcagctgccagccaactcagtcacc
aaggtctccatccagtttgagcgggcactgctcaagtggaccgagtacaccccggacccc
aaccatggcttctatgtcagcccatctgtcctcagcgcccttgtgcccagcatcgtagca
tccaaacccgtggactgggaagagagccccctcttcaacagcctcttcccaggctccgac
agctccagctactttgtgcggctctacacggagccactgctggtgaacctgccgacgccg
gacttcagcatgccctacaatgtcatctgcctcacgtgcacggtggtggccgtgtgctat
ggctccttctacaacctcctcacccgaaccttccacatcgaggagcccagcaagggcggc
ttggccaagcggctggctaacctcatccggcgcgcccgtggcgtccccccgctctga

DBGET integrated database retrieval system