KEGG   Equus caballus (horse): 100056635
Entry
100056635         CDS       T01058                                 

Gene name
EGLN3
Definition
(RefSeq) egl nine homolog 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100056635 (EGLN3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056635 (EGLN3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100056635 (EGLN3)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     100056635 (EGLN3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 100056635
NCBI-ProteinID: XP_003363719
Ensembl: ENSECAG00000005086
VGNC: 17461
UniProt: F7CIB5
LinkDB
Position
1
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCSGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESSLTED
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcccttgggacacatcatgaggctggatctggagaaaatcgccctggagtacatcgtg
ccctgtctgcacgaggttggcttctgctacctggacaacttcctaggcgaggtggtgggc
gactgcgtcctggagcgcgtcaagcagctgcactgcagcggggccctgagggacggccag
ctggccgggccgcgcgccggcgtctccaagcggcacctgcggggcgaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcagcttcctcctgtccctcatcgacagg
ctggtcctgtactgcgggagccggctgggcaaatactacgtcaaggagaggtccaaggcg
atggtggcttgctacccgggaaatggaacaggttatgttcgacatgtagacaaccccaac
ggtgacggccgctgcatcacctgcatctactatctgaacaagaattgggatgccaagtta
cacggtggggtcctgcggatatttccagaagggaaatcattcatagcggatgtggagccc
atttttgacagactcttattcttctggtcagaccgcaggaacccacatgaagtccagcct
tcctatgcgaccagatacgctatgactgtttggtactttgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactagaaaaactgaatcttccctcactgaagactga

KEGG   Equus caballus (horse): 100060551
Entry
100060551         CDS       T01058                                 

Gene name
EGLN1
Definition
(RefSeq) egl nine homolog 1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100060551 (EGLN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060551 (EGLN1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100060551 (EGLN1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     100060551 (EGLN1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 zf-MYND 2OG-FeII_Oxy_4 zf-Mss51 zf-C6H2
Other DBs
NCBI-GeneID: 100060551
NCBI-ProteinID: XP_014588968
Ensembl: ENSECAG00000021704
VGNC: 51494
LinkDB
Position
1
AA seq 430 aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCSKEHQRQDWKKHKLVCQS
GDGGPGQGAGQPRHAGSAPPLRAGGAGAREARKAAPRRDSAAPAAEAAGPPAAGGATKAK
AKAKPAADPAAAASSPRAAPGGQGPAEAGKEEALARSPPYQEKANLYPPSNTPGEGLSHG
GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFT
DGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGNYKINGRT
KAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADI
EPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNK
PSDSITKDVL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccaatgacagcggtgggcccggcgggccgagtccgagcgagcgagaccggcagtac
tgcgagctgtgcgggaagatggagaacctgctgcgctgcagccgctgccgcagctccttc
tactgcagcaaggagcaccagcggcaggactggaagaagcacaagctcgtgtgccagagc
ggcgacggcggccccggccagggggcgggccagccccggcacgccggctccgcgccgccg
ctccgggccggcggggccggggccagggaggcccggaaggcagcgccgcgccgggacagc
gccgcccccgccgccgaggccgcgggcccgccggccgccggaggcgcgaccaaggcaaag
gcaaaggccaagcccgcggccgaccccgcggcggccgcgtcctcgcctcgcgcggcaccc
ggcggccagggcccggcggaggccgggaaggaggaggcgctggcccgctcgccgccgtac
caggagaaggcgaacctgtacccgccgagtaacacgccgggcgaggggctgagccacggc
ggcggcctgcggcccaacgggcagacgaagccgctgccggcgctgaagctggcgctggag
tacatcgtgccgtgcatgaacaagcacggcatctgcgtggtggacgacttcctgggcaag
gagactgggcagcagatcggcgacgaggtgcgcgccctgcacgacaccggcaagttcacg
gacggccagctggtcagccagaagagcgactcgtccaaggacatccgaggcgataagatc
acctggatcgagggcaaggagcccggctgcgagaccatcgggctgctcatgagcagcatg
gacgacctgatccgccactgtaacgggaagctgggcaactacaaaatcaatggccggacg
aaagctatggttgcttgttatccaggcaatggaacaggttatgtacgccatgttgataat
ccaaatggagatggaagatgtgtgacatgtatatattatcttaataaagactgggatgcc
aaggtaagtggaggtatacttcgaatttttccagaaggcaaagcccagtttgctgacatt
gaacccaaatttgatagactgctgtttttctggtctgaccgtcgcaaccctcatgaagta
caaccagcatatgctacaaggtacgcaatcactgtttggtattttgatgcagatgagaga
gcccgtgctaaagtaaaatatctaacaggtgaaaaaggtgtgagggttgaactcaataaa
ccttctgattcaatcactaaagacgtcttatag

KEGG   Equus caballus (horse): 100064859
Entry
100064859         CDS       T01058                                 

Gene name
EGLN2
Definition
(RefSeq) egl nine homolog 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100064859 (EGLN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064859 (EGLN2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100064859 (EGLN2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     100064859 (EGLN2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 100064859
NCBI-ProteinID: XP_023505544
LinkDB
Position
10
AA seq 405 aa
MDSPCQPQPLNQALPQLLDSVSEPLEPGRARMGVESYLPCSLLPSYHCPGVPGEASAGSG
TPRATASSTTASPLREGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWA
EDGGDAPAPSKRPWAKQENQEAEGEGQGGVGCSSGNGEASAGPREEVLPAAPERLALDYI
VPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAW
VEGHEPGCRSIGALMAHVDAVIRHCAGRLGGYVINGRTKAMVACYPGNGLGYVRHVDNPH
GDGRCITCIYYLNQNWDIKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKP
AYATRYAITVWYFDAKERAAAKDKYLLASGQKGVQVPVSQPTTPT
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcagcccctgaatcaagctctccctcagttgctggattct
gtgtcagagcccttggagcctggccgggccaggatgggggtggaaagttacctgccctgt
tccttgctaccctcttaccactgtccaggagtgcctggtgaggcctcggcggggagtggg
acccccagagccacagcctcttccaccacagccagccccctgcgggagggctttggcggg
caggatggcggcgaactgcggccgctgcagagtgagggcgctgcagcgctggtcaccaag
gggtgccagagactggcggcccagggcgcccggcctgaggctcccaaacggaaatgggca
gaggatggtggggatgcccccgcacccagcaagcggccctgggcaaagcaggagaaccag
gaggcggagggggaggggcagggtggcgtgggctgcagcagtggcaatggcgaggccagc
gccgggccgagggaggaggtgctgcccgctgcccctgagcgcttggccctggactatatt
gtgccctgcatgcggtactatggcatctgcgtcaaggacagcttcctgggggcggcgctg
ggtggccgcgtgctggccgaggtggaggccctgaagcggggcgggcgcctgcgtgacggg
cagctagtgagccagcgggctatcccgccacgcagcatccgcggggaccagatcgcctgg
gtggagggccacgagccgggctgccgcagcatcggcgccctcatggcccacgtggacgcc
gtcatccggcactgcgccgggcggctgggcggctacgtcatcaacgggcgcaccaaggcc
atggtggcgtgttacccaggcaatgggctggggtacgtgaggcacgttgacaatccccac
ggcgatgggcgctgcatcacctgtatctattacctgaatcagaactgggacatcaaggtg
catggcggcttgctacagatcttccctgagggccggcccgtggtagccaacatcgagccc
ctctttgaccgcctgctcattttctggtctgaccggcggaacccccatgaggtgaaacca
gcctatgccaccaggtacgccatcactgtctggtattttgatgccaaggagagagcagca
gccaaagacaagtatctgctagcatcaggacagaaaggtgtccaagtccctgtgtcacag
ccgactacacccacctag

DBGET integrated database retrieval system