KEGG   Equus caballus (horse): 100056857
Entry
100056857         CDS       T01058                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04360  Axon guidance
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04931  Insulin resistance
ecb05168  Herpes simplex virus 1 infection
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05220  Chronic myeloid leukemia
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100056857 (PTPN11)
   04630 JAK-STAT signaling pathway
    100056857 (PTPN11)
   04072 Phospholipase D signaling pathway
    100056857 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100056857 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100056857 (PTPN11)
   04670 Leukocyte transendothelial migration
    100056857 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100056857 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100056857 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    100056857 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100056857 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100056857 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100056857 (PTPN11)
   05211 Renal cell carcinoma
    100056857 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100056857 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100056857 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100056857 (PTPN11)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100056857 (PTPN11)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100056857 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100056857
NCBI-ProteinID: XP_023502893
Ensembl: ENSECAG00000024560
VGNC: 22011
LinkDB
Position
8
AA seq 601 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQVKPQE
LKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKL
AETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGD
PNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMT
TKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTE
RTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVI
DILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEE
QKSKRKGHEYTNIKYSLTDQTSGDQSPLPPCTPTPSCAEMREDSARVYENVGLMQQQKSF
R
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccgaacattactggcgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcccagtaagagtaaccctggagac
ttcacactttccgttagaagaaatggagcggtcacgcacatcaagattcagaacactggg
gattactatgacttgtatggaggggagaagtttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattaaaggagaagaatggagacgttattgagctcaaatat
cctctgaactgcgcagatcctacctctgaaaggtggtttcatggacacctgtctgggaaa
gaagcagagaaattattaacggagaaaggaaaacacggcagctttcttgtgcgagagagc
cagagccaccctggagattttgttctctctgtccgaactggtgatgacaaaggagagagc
aatgacggcaagtctaaagtgacccacgtcatgatccgctgtcaggtaaagccccaggaa
ctgaaatatgatgttggtggaggagaacggtttgactctttgacagatctcgtggagcat
tacaagaagaatcccatggtagaaacattgggcacagtattacaactcaagcagcccctc
aacacaactcgtatcaatgctgcggaaatagaaagccgggttcgagaactgagcaaattg
gctgagaccacagataaagtcaaacaaggcttttgggaagaatttgagacactacaacag
caggagtgcaaacttctctacagccgaaaagagggtcagaggcaagaaaataaaaacaaa
aacagatataaaaacatcctgccctttgatcataccagggttgtcctgcatgatggtgat
cccaacgagcctgtttcggattacatcaatgcaaatattatcatgcctgagtttgaaacc
aagtgcaacaattcaaagcccaaaaagagttatattgccacacaaggctgtctgcaaaat
acggtgaatgacttttggcggatggtgtttcaagagaattcccgagtgattgtcatgaca
acgaaagaagtggagcgaggaaagagtaaatgtgtcaaatactggcctgacgagtatgct
ctaaaagaatatggggtcatgcgtgttaggaacgtcaaagagagtgccgctcatgactac
acgttaagagaacttaaactctcaaaggttggacaagctctactccaggggaatacggag
agaacggtctggcaataccactttcggacctggccagaccatggagtgcccagtgaccct
gggggcgtgctggacttcctggaggaggtccaccataagcaggagagcatcatggacgct
gggcctgtggtggttcactgcagtgctggaattggccggacagggacgttcattgtgata
gatatccttattgacatcatcagagagaaaggtgttgactgcgacattgacgtgcccaaa
accattcagatggtgcggtctcagaggtcagggatggtccagacagaagcacagtaccga
ttcatctacatggccgtccagcattatatcgaaacactacagcgcaggattgaagaagag
cagaaaagcaagcggaaagggcatgaatatacaaatattaagtattccctaacggaccag
acaagtggagatcaaagtcccctcccgccttgtaccccaacaccgtcctgtgcagaaatg
agagaagatagtgctagagtctatgaaaatgtggggctgatgcagcagcaaaaaagtttc
agatga

KEGG   Equus caballus (horse): 100146191
Entry
100146191         CDS       T01058                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04360  Axon guidance
ecb04625  C-type lectin receptor signaling pathway
ecb04630  JAK-STAT signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04931  Insulin resistance
ecb05168  Herpes simplex virus 1 infection
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05220  Chronic myeloid leukemia
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100146191
   04630 JAK-STAT signaling pathway
    100146191
   04072 Phospholipase D signaling pathway
    100146191
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100146191
   04650 Natural killer cell mediated cytotoxicity
    100146191
   04670 Leukocyte transendothelial migration
    100146191
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100146191
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100146191
  09158 Development and regeneration
   04360 Axon guidance
    100146191
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100146191
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100146191
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100146191
   05211 Renal cell carcinoma
    100146191
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100146191
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100146191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100146191
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100146191
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100146191
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100146191
NCBI-ProteinID: XP_023491830
LinkDB
Position
2
AA seq 617 aa
MTSRRWFHPNIGGVEAEQLLLSQGQHGSFLARPSRSCPGGFTLSVRWVVPWPGVDSLRSQ
EASKGLSTLSCRRRRHDEVTHIKIQNTGDYYDLYGGEKFATLAELVQHYMDQRGGLLRER
SGAPVELRHPLGCQDPTTERWYHGHLSGKEAEKLLMEKGRPGSFLVRESQSKPGDFVLSV
LTQQPDKADRRPRVTHVMIHFQTGSSTWGVGSSSTLLETWSSATGRTPWWRSRGPWCISS
SPSRPRGSMPQASRTACRSSVRLQKPPRRPSRASGRSLRCCSSRNAGSCFPGRRDSGQRT
SPRIATRTSSPLTPPVLPCMTWTAASLELTTSTPTTSGKQLILTHFQSDPEEKPGHGLGK
VYIATQGCLQTTVAAFWAMVHQENTRVIVMTTREVERGRNKCFRYWPQLHDSQEYGRVCV
CSMAEYQAQGYCVRELQVWRPDQEEPPRAVKHYQYFSWPDHGVPAEPAGVLGFLDEVNRA
QSSMPGAGPMVVHCSAGIGRTGTIIVIDILVDVIRRQGLDCDIDVPTTIQLVRRQRSGMV
QTEAQYKFVYLALQRYIQGEQLRLREQRARPEEPDYLNVGSAPADPHSSPAPAPIRAPAT
TPEPSGGVYENLPGLGR
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgacctcgcgcaggtggtttcaccccaacattggcggggtcgaggcggagcagctgctc
ctgtcccagggccagcacgggagcttcctggccagacccagcaggagctgtcccgggggc
ttcacactgtctgtcaggtgggtggtgccatggccaggcgtggacagtctgcggtcccag
gaggcctcaaagggtctgagcaccctcagctgcaggcgcaggcgccacgacgaggtgacc
cacattaagatccagaacacgggtgactactatgacctgtatggaggagagaagttcgcg
acgctggcagagctggtgcagcactacatggaccagcgcgggggactgctccgcgagcgc
agcggggcccccgtcgagctgcgacacccgctgggctgccaggaccccacgaccgaacgg
tggtaccatgggcacctgtctggcaaggaggctgagaagctgctgatggagaagggacgt
ccaggcagcttcctggtgcgggagagtcagagcaagcctggggactttgtgctgtcggtg
ctcacacagcagccggacaaggctgaccgccggcctcgggtcactcacgtcatgattcac
ttccagacgggaagttcgacgtggggggtggggagcagttccacactcttggagacctgg
tcgagcgctacaggaagaaccccatggtggagaagtcgggggccgtggtgcatctcaagc
agcccctcaaggccacgaggatcaatgccgcaagcatcgagaaccgcgtgcaggagctca
gtaagactacagaagccaccgagaaggccaagcagggcttctgggaggagtttgagatgc
tgcagcagcaggaatgccggctcctgtttccccggaaggagggacagcggccagagaaca
agcccaagaatcgctacaagaacatcctcccctttgacaccacccgtgttgccctgcatg
acgtggaccgcagcgtccctggagctgactacatcaacgccaactacatcaggcaagcag
ttaatcctcacccacttccagagtgacccagaggagaagccaggccatggactgggcaag
gtgtacatcgctacccaggggtgtctgcagaccacagtggctgccttctgggccatggtg
caccaggagaacacacgggtcatcgtcatgaccaccagggaggtggaacgaggccggaac
aagtgtttccgatactggccccagctacatgacagccaagagtatggccgtgtgtgtgtg
tgcagtatggctgagtaccaggcccagggctactgtgtgcgggagttgcaggtgtggcgg
ccagaccaggaagagccgccgcgcgcggtgaagcactaccagtacttcagctggccggac
cacggggtcccggccgagcccgccggcgtccttggcttcctggacgaggtgaaccgggcc
cagagcagcatgcccggggccggacccatggtggtgcactgcagcgccggcatcggacgc
acaggcaccatcatcgtgattgacatcctggtggacgtcatccgcaggcaagggctggac
tgcgacatcgacgtccccacaacgattcagctggtgcggcggcagcgctcggggatggtg
cagaccgaggcgcagtacaagttcgtgtacctggcgctgcagcggtacatccagggcgag
cagctgcgcctgcgcgagcagcgcgcccggccggaggagcccgactacctgaacgtgggc
tccgcgcccgccgacccccacagcagcccggcacccgcgccgatccgggcgcccgccacg
acccccgagccctccggcggcgtgtacgagaacctgcccggcctcgggcggtga

DBGET integrated database retrieval system