KEGG   Equus caballus (horse): 100057148
Entry
100057148         CDS       T01058                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2 isoform X2
  KO
K12966  absent in melanoma 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04621  NOD-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100057148 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100057148 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 100057148
NCBI-ProteinID: XP_014595286
Ensembl: ENSECAG00000014480
UniProt: A0A3Q2H1W9
LinkDB
Position
5
AA seq 347 aa
MESKYKEILLLTGLDNITDEELDRFKFFLPDELKVSTAKLENANRTEVANLMIQNVGAVS
AVTKTIHVFQKLNYMHVAKSLQEEKEKVDKKYKGKKGTQQVKKRSQTEMSPGASAAPRNS
VVEQHIAPEVSPHVKPKQKQMVAKQEPIRKEGLQKGSMTVMVLKATKPFEFETKEGKQEM
FHATVATESEFFFVKVFNKKLKDKFTPKNIIIISKYYWHSHFLEVNSVSRVSDAKSDQQI
SVPKHIIRKAGETPKINKLQTQPHGTIVNGVFVIQKKTERRNHQLFDLSDSTGRMEVLVL
GKQNKIECEEGDKLRLTFFELSRTGEKLQLKSGIHSLVKVIKAKKLK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggaaatcctcttattaactggcctggataacatcactgatgag
gaactggatcgatttaaattcttccttccagatgagttaaaagtctccacagcaaaacta
gaaaatgcaaataggacagaggtagcaaacttgatgattcaaaatgttggtgcagtgtct
gcagtgacgaagaccatacatgttttccagaagctgaattatatgcatgtggcaaaaagt
cttcaggaagagaaggagaaagttgataagaaatacaaagggaaaaaaggaacacagcaa
gtgaaaaagagaagtcaaactgaaatgagtcctggtgcctctgcagctcccagaaatagt
gtcgtggagcaacacattgcaccagaagtctctcctcatgttaagcctaagcagaaacag
atggtggccaagcaggaacctatcaggaaagaagggttgcagaaaggctctatgacagtc
atggtgctgaaagcaacgaagccattcgaatttgagaccaaagaagggaagcaagagatg
tttcacgctacagtggctactgagagtgaattcttttttgtaaaagttttcaacaaaaag
ctaaaggataaattcactccaaagaatataattataatatccaaatattattggcacagt
catttcctggaagtgaatagtgtctcacgtgtatctgatgccaaatctgaccaacaaatc
agtgtcccaaagcacattatcagaaaagctggtgaaaccccaaagatcaataagcttcaa
actcagccccatggaacaattgtgaatggggtgtttgtaatccagaagaaaacagaacgg
aggaatcatcagttatttgacctaagtgacagtacagggaggatggaagtgttggtgctt
ggaaaacagaacaaaattgaatgcgaagaaggggataaacttcgacttacgttctttgag
ctatcaagaactggagaaaaactacagctgaaatctggaattcacagtttagttaaggtt
attaaggcaaaaaaactgaaatga

DBGET integrated database retrieval system