KEGG   Equus caballus (horse): 100057165
Entry
100057165         CDS       T01058                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X2
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00230  Purine metabolism
ecb01100  Metabolic pathways
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100057165 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100057165 (FHIT)
   05223 Non-small cell lung cancer
    100057165 (FHIT)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     100057165 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C CwfJ_C_1
Other DBs
NCBI-GeneID: 100057165
NCBI-ProteinID: XP_014587051
UniProt: A0A5F5PVA3
LinkDB
Position
16
AA seq 149 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLRPEEVADLFQ
ATQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHIHVLPRKAGDFHRNDSIYEELQKH
DKEEEDSPALWRSEEDMAAEAAALRVYFQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcattcagattcggccagcatctcatcaagccctctgtggtgtttctcaaaacagaa
ctatcctttgccctcgtgaacaggaaacctgtggtaccaggacatgtcctggtgtgtccc
cttcggccagtggagcgcttccgagacctgcgtcctgaggaagtggctgatttgtttcag
gcaacccagagagtggggacagtggtggagaagcatttccaggggacttctctcaccttt
tccatgcaggatggccccgaagccggacaaactgtgaagcacgttcacatccacgttctt
ccaaggaaggctggagactttcacaggaatgacagcatctatgaggagctccagaaacat
gacaaggaggaggaggactccccagccttgtggagatcggaggaggacatggcagcggaa
gctgcagcactgcgggtctactttcaatga

DBGET integrated database retrieval system