Equus caballus (horse): 100057483 Help Entry 100057483         CDS       T01058                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism ecb  Equus caballus (horse) Pathway ecb01523   Antifolate resistance ecb04010   MAPK signaling pathway ecb04014   Ras signaling pathway ecb04024   cAMP signaling pathway ecb04062   Chemokine signaling pathway ecb04064   NF-kappa B signaling pathway ecb04066   HIF-1 signaling pathway ecb04071   Sphingolipid signaling pathway ecb04137   Mitophagy - animal ecb04151   PI3K-Akt signaling pathway ecb04210   Apoptosis ecb04211   Longevity regulating pathway ecb04218   Cellular senescence ecb04380   Osteoclast differentiation ecb04613   Neutrophil extracellular trap formation ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04625   C-type lectin receptor signaling pathway ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04668   TNF signaling pathway ecb04722   Neurotrophin signaling pathway ecb04917   Prolactin signaling pathway ecb04920   Adipocytokine signaling pathway ecb04926   Relaxin signaling pathway ecb04931   Insulin resistance ecb04932   Non-alcoholic fatty liver disease ecb04933   AGE-RAGE signaling pathway in diabetic complications ecb04936   Alcoholic liver disease ecb05010   Alzheimer disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05030   Cocaine addiction ecb05132   Salmonella infection ecb05133   Pertussis ecb05134   Legionellosis ecb05135   Yersinia infection ecb05140   Leishmaniasis ecb05142   Chagas disease ecb05145   Toxoplasmosis ecb05146   Amoebiasis ecb05152   Tuberculosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05165   Human papillomavirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05202   Transcriptional misregulation in cancer ecb05203   Viral carcinogenesis ecb05207   Chemical carcinogenesis - receptor activation ecb05208   Chemical carcinogenesis - reactive oxygen species ecb05212   Pancreatic cancer ecb05215   Prostate cancer ecb05220   Chronic myeloid leukemia ecb05221   Acute myeloid leukemia ecb05222   Small cell lung cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05321   Inflammatory bowel disease ecb05415   Diabetic cardiomyopathy ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100057483 (RELA)    04014 Ras signaling pathway     100057483 (RELA)    04064 NF-kappa B signaling pathway     100057483 (RELA)    04668 TNF signaling pathway     100057483 (RELA)    04066 HIF-1 signaling pathway     100057483 (RELA)    04071 Sphingolipid signaling pathway     100057483 (RELA)    04024 cAMP signaling pathway     100057483 (RELA)    04151 PI3K-Akt signaling pathway     100057483 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100057483 (RELA)   09143 Cell growth and death    04210 Apoptosis     100057483 (RELA)    04218 Cellular senescence     100057483 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100057483 (RELA)    04620 Toll-like receptor signaling pathway     100057483 (RELA)    04621 NOD-like receptor signaling pathway     100057483 (RELA)    04622 RIG-I-like receptor signaling pathway     100057483 (RELA)    04623 Cytosolic DNA-sensing pathway     100057483 (RELA)    04625 C-type lectin receptor signaling pathway     100057483 (RELA)    04660 T cell receptor signaling pathway     100057483 (RELA)    04658 Th1 and Th2 cell differentiation     100057483 (RELA)    04659 Th17 cell differentiation     100057483 (RELA)    04657 IL-17 signaling pathway     100057483 (RELA)    04662 B cell receptor signaling pathway     100057483 (RELA)    04062 Chemokine signaling pathway     100057483 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100057483 (RELA)    04917 Prolactin signaling pathway     100057483 (RELA)    04926 Relaxin signaling pathway     100057483 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100057483 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     100057483 (RELA)   09149 Aging    04211 Longevity regulating pathway     100057483 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100057483 (RELA)    05202 Transcriptional misregulation in cancer     100057483 (RELA)    05207 Chemical carcinogenesis - receptor activation     100057483 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     100057483 (RELA)    05203 Viral carcinogenesis     100057483 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100057483 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     100057483 (RELA)    05221 Acute myeloid leukemia     100057483 (RELA)    05220 Chronic myeloid leukemia     100057483 (RELA)    05215 Prostate cancer     100057483 (RELA)    05222 Small cell lung cancer     100057483 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100057483 (RELA)    05170 Human immunodeficiency virus 1 infection     100057483 (RELA)    05161 Hepatitis B     100057483 (RELA)    05160 Hepatitis C     100057483 (RELA)    05171 Coronavirus disease - COVID-19     100057483 (RELA)    05164 Influenza A     100057483 (RELA)    05162 Measles     100057483 (RELA)    05168 Herpes simplex virus 1 infection     100057483 (RELA)    05163 Human cytomegalovirus infection     100057483 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     100057483 (RELA)    05169 Epstein-Barr virus infection     100057483 (RELA)    05165 Human papillomavirus infection     100057483 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100057483 (RELA)    05135 Yersinia infection     100057483 (RELA)    05133 Pertussis     100057483 (RELA)    05134 Legionellosis     100057483 (RELA)    05152 Tuberculosis     100057483 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     100057483 (RELA)    05145 Toxoplasmosis     100057483 (RELA)    05140 Leishmaniasis     100057483 (RELA)    05142 Chagas disease     100057483 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     100057483 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     100057483 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     100057483 (RELA)   09165 Substance dependence    05030 Cocaine addiction     100057483 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100057483 (RELA)    05418 Fluid shear stress and atherosclerosis     100057483 (RELA)    05415 Diabetic cardiomyopathy     100057483 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100057483 (RELA)    04932 Non-alcoholic fatty liver disease     100057483 (RELA)    04931 Insulin resistance     100057483 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     100057483 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100057483 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ecb03000]     100057483 (RELA) Transcription factors [BR:ecb03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     100057483 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  100057483 NCBI-ProteinID:  XP_023510230 Ensembl:  ENSECAG00000013763 VGNC:  22293 LinkDB All DBs Position 12:complement(29516707..29525958) Genome browser AA seq 551 aa AA seqDB search MEDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSISDM DFSALLSQISS NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt atggaagacctgttccccctcatcttcccttcggagccagcccaggcttctggcccctat gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctcagcgggcagcatcccgggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac cctcctcaccggcctcacccccacgagcttgtggggaaagactgccgggacggcttctat gaggctgagctctgccctgaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctatgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctttct catcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtgaac cggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtgcag aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagccgatgttcaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc agcgagcccatggagttccagtatttgccagacacagatgatcgtcaccgaattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcccccgccccggcgcattgctgtgcctgcccgcagctcagcctcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt gaggaattttcccccatggtctttccttctgggacgatcccaagccagacctcggccttg gcaccagcccctgccccagtcctggcacaggccccagcccctgccccagccatggcatca gctctggcccaggccccagctcccgtccctgtcctagccgcaggccttgctcaggccgtg gccccgcctgcccccaggaccacccaagctggggaagggacactgacggaggccctgctg cagctgcagtttgatgctgatgaagacctgggggccctgctcggcaataacactgacccg gccgtgttcacggacctggcatctgtcgacaactctgagtttcagcagctgctgaaccag ggtgtctctatggccccccacacagctgagcccatgctgatggagtaccctgaggctata actcgcctgatgtcagggtcccagcggccccctgacccagctcccgctcccctgggggcc tctgggctccccaacggtctcctctcaggggacgaagacttctcctccatttcggacatg gacttctcagcccttctgagtcagatcagctcctag

DBGET integrated database retrieval system