KEGG   Equus caballus (horse): 100057483
Entry
100057483         CDS       T01058                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04137  Mitophagy - animal
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04218  Cellular senescence
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04917  Prolactin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04926  Relaxin signaling pathway
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05030  Cocaine addiction
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05134  Legionellosis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05321  Inflammatory bowel disease
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100057483 (RELA)
   04014 Ras signaling pathway
    100057483 (RELA)
   04064 NF-kappa B signaling pathway
    100057483 (RELA)
   04668 TNF signaling pathway
    100057483 (RELA)
   04066 HIF-1 signaling pathway
    100057483 (RELA)
   04071 Sphingolipid signaling pathway
    100057483 (RELA)
   04024 cAMP signaling pathway
    100057483 (RELA)
   04151 PI3K-Akt signaling pathway
    100057483 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100057483 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100057483 (RELA)
   04218 Cellular senescence
    100057483 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100057483 (RELA)
   04621 NOD-like receptor signaling pathway
    100057483 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100057483 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100057483 (RELA)
   04625 C-type lectin receptor signaling pathway
    100057483 (RELA)
   04660 T cell receptor signaling pathway
    100057483 (RELA)
   04658 Th1 and Th2 cell differentiation
    100057483 (RELA)
   04659 Th17 cell differentiation
    100057483 (RELA)
   04657 IL-17 signaling pathway
    100057483 (RELA)
   04662 B cell receptor signaling pathway
    100057483 (RELA)
   04062 Chemokine signaling pathway
    100057483 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100057483 (RELA)
   04917 Prolactin signaling pathway
    100057483 (RELA)
   04926 Relaxin signaling pathway
    100057483 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100057483 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100057483 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100057483 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057483 (RELA)
   05202 Transcriptional misregulation in cancer
    100057483 (RELA)
   05203 Viral carcinogenesis
    100057483 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100057483 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100057483 (RELA)
   05221 Acute myeloid leukemia
    100057483 (RELA)
   05220 Chronic myeloid leukemia
    100057483 (RELA)
   05215 Prostate cancer
    100057483 (RELA)
   05222 Small cell lung cancer
    100057483 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100057483 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100057483 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100057483 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100057483 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100057483 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100057483 (RELA)
   04931 Insulin resistance
    100057483 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100057483 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100057483 (RELA)
   05135 Yersinia infection
    100057483 (RELA)
   05133 Pertussis
    100057483 (RELA)
   05134 Legionellosis
    100057483 (RELA)
   05152 Tuberculosis
    100057483 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100057483 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100057483 (RELA)
   05161 Hepatitis B
    100057483 (RELA)
   05160 Hepatitis C
    100057483 (RELA)
   05171 Coronavirus disease - COVID-19
    100057483 (RELA)
   05164 Influenza A
    100057483 (RELA)
   05162 Measles
    100057483 (RELA)
   05168 Herpes simplex virus 1 infection
    100057483 (RELA)
   05163 Human cytomegalovirus infection
    100057483 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100057483 (RELA)
   05169 Epstein-Barr virus infection
    100057483 (RELA)
   05165 Human papillomavirus infection
    100057483 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100057483 (RELA)
   05145 Toxoplasmosis
    100057483 (RELA)
   05140 Leishmaniasis
    100057483 (RELA)
   05142 Chagas disease
    100057483 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100057483 (RELA)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100057483 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100057483
NCBI-ProteinID: XP_023510230
Ensembl: ENSECAG00000013763
VGNC: 22293
LinkDB
Position
12
AA seq 551 aa
MEDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV
APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSISDM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggaagacctgttccccctcatcttcccttcggagccagcccaggcttctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctcagcgggcagcatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtggggaaagactgccgggacggcttctat
gaggctgagctctgccctgaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctatgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctttct
catcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtgaac
cggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagccgatgttcaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc
agcgagcccatggagttccagtatttgccagacacagatgatcgtcaccgaattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcccccgccccggcgcattgctgtgcctgcccgcagctcagcctcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt
gaggaattttcccccatggtctttccttctgggacgatcccaagccagacctcggccttg
gcaccagcccctgccccagtcctggcacaggccccagcccctgccccagccatggcatca
gctctggcccaggccccagctcccgtccctgtcctagccgcaggccttgctcaggccgtg
gccccgcctgcccccaggaccacccaagctggggaagggacactgacggaggccctgctg
cagctgcagtttgatgctgatgaagacctgggggccctgctcggcaataacactgacccg
gccgtgttcacggacctggcatctgtcgacaactctgagtttcagcagctgctgaaccag
ggtgtctctatggccccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctgatgtcagggtcccagcggccccctgacccagctcccgctcccctgggggcc
tctgggctccccaacggtctcctctcaggggacgaagacttctcctccatttcggacatg
gacttctcagcccttctgagtcagatcagctcctag

KEGG   Equus caballus (horse): 100067894
Entry
100067894         CDS       T01058                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor NF-kappa-B p105 subunit isoform X4
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04211  Longevity regulating pathway
ecb04218  Cellular senescence
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04917  Prolactin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04926  Relaxin signaling pathway
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05010  Alzheimer disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05030  Cocaine addiction
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05134  Legionellosis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05203  Viral carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05321  Inflammatory bowel disease
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100067894 (NFKB1)
   04014 Ras signaling pathway
    100067894 (NFKB1)
   04064 NF-kappa B signaling pathway
    100067894 (NFKB1)
   04668 TNF signaling pathway
    100067894 (NFKB1)
   04066 HIF-1 signaling pathway
    100067894 (NFKB1)
   04071 Sphingolipid signaling pathway
    100067894 (NFKB1)
   04024 cAMP signaling pathway
    100067894 (NFKB1)
   04151 PI3K-Akt signaling pathway
    100067894 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100067894 (NFKB1)
   04218 Cellular senescence
    100067894 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100067894 (NFKB1)
   04621 NOD-like receptor signaling pathway
    100067894 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    100067894 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    100067894 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    100067894 (NFKB1)
   04660 T cell receptor signaling pathway
    100067894 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    100067894 (NFKB1)
   04659 Th17 cell differentiation
    100067894 (NFKB1)
   04657 IL-17 signaling pathway
    100067894 (NFKB1)
   04662 B cell receptor signaling pathway
    100067894 (NFKB1)
   04062 Chemokine signaling pathway
    100067894 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100067894 (NFKB1)
   04917 Prolactin signaling pathway
    100067894 (NFKB1)
   04926 Relaxin signaling pathway
    100067894 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100067894 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100067894 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    100067894 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067894 (NFKB1)
   05202 Transcriptional misregulation in cancer
    100067894 (NFKB1)
   05206 MicroRNAs in cancer
    100067894 (NFKB1)
   05203 Viral carcinogenesis
    100067894 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100067894 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100067894 (NFKB1)
   05221 Acute myeloid leukemia
    100067894 (NFKB1)
   05220 Chronic myeloid leukemia
    100067894 (NFKB1)
   05215 Prostate cancer
    100067894 (NFKB1)
   05222 Small cell lung cancer
    100067894 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100067894 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100067894 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100067894 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100067894 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100067894 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100067894 (NFKB1)
   04931 Insulin resistance
    100067894 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100067894 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100067894 (NFKB1)
   05135 Yersinia infection
    100067894 (NFKB1)
   05133 Pertussis
    100067894 (NFKB1)
   05134 Legionellosis
    100067894 (NFKB1)
   05152 Tuberculosis
    100067894 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100067894 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    100067894 (NFKB1)
   05161 Hepatitis B
    100067894 (NFKB1)
   05160 Hepatitis C
    100067894 (NFKB1)
   05171 Coronavirus disease - COVID-19
    100067894 (NFKB1)
   05164 Influenza A
    100067894 (NFKB1)
   05162 Measles
    100067894 (NFKB1)
   05168 Herpes simplex virus 1 infection
    100067894 (NFKB1)
   05163 Human cytomegalovirus infection
    100067894 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100067894 (NFKB1)
   05169 Epstein-Barr virus infection
    100067894 (NFKB1)
   05165 Human papillomavirus infection
    100067894 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100067894 (NFKB1)
   05145 Toxoplasmosis
    100067894 (NFKB1)
   05140 Leishmaniasis
    100067894 (NFKB1)
   05142 Chagas disease
    100067894 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100067894 (NFKB1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100067894 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 100067894
NCBI-ProteinID: XP_005608646
Ensembl: ENSECAG00000015042
VGNC: 20712
LinkDB
Position
3
AA seq 1003 aa
MKDLQLLVDVLNWLLCGNGRQQYPMSDFGNVSRMAEDDPYLGGHEQMFHLESLNHTMFNP
ELFTQEVSLPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICN
YVGPAKVIVQLVTNGKHTHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKK
VFETLEARMTEACVRGYNPEILVHPDLRYLQAEGGGDRQLTDREKEVIHQAALQQTKEMD
LSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEI
YLLCDKVQKDDIQIRFYEEEENGGIWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPAS
VFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMF
GGGGGGGGAGSTGPGYGFPHYGFPTYGGITFHPGAAKSNAGMKHGTIDTSCKNDPEGCDA
SDDREAVNLSGKGTETTARKESGGGADAIAPAPPAGAEEGRSCCQDNLFLEKAMQLAKRH
ANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLVSD
DIINMRNDLYQTPLHLAVITKQEAVVEDLLRAGADLSLLDRFGNSALHLAAKEGHDKILG
ILLKHKKAALLINHPNADGLNAIHIAMMSNSMPCLRLLVTAGADVNAQERKSGRTALHLA
VERDNISLAGCLLLEGEAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEP
LYDLDDSWEENGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLT
EDAKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKEL
VDALRQMGYTEAVEVIQAAFCTSGTAAPSPVTTTSQAPLLPLAPASTRQQIDELREDSVC
DSGVETSFRRLSFTESLTSGSSLLTLNKMPHDYMQEGPIEGKI
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgaaagatctccagcttttggtagatgtgctgaattggcttttatgtggaaatggaagg
cagcaatatcccatgagtgacttcggtaacgtctccagaatggcagaagacgatccatat
ttgggaggtcatgaacaaatgtttcatttggagtctttgaatcatacaatgtttaatccc
gaattatttacacaagaggtgtcactacccacagatggcccataccttcaaatattagag
caacctaaacagagaggatttcgtttccgttatgtgtgtgaaggcccatcccacggtgga
ctgcccggtgcgtctagtgaaaagaacaagaagtcctaccctcaggtcaaaatctgcaac
tacgtgggacctgcaaaggttattgttcagttggtcacaaatggaaaacacacccacctg
catgcacacagtttagtgggaaaacactgtgaggacgggatctgcacggtgactgctgga
cccaaggacatggtggtcggttttgcaaacctgggtatacttcatgtgacaaagaaaaaa
gtatttgaaacactggaagcccgaatgacagaggcctgtgtcaggggctataaccccgaa
attttggtgcatcctgatcttcgttatttgcaggcagaaggcggaggagaccggcagctc
acggatcgggaaaaggaggtcatccaccaggcagctcttcagcagacgaaggagatggac
ctcagcgtggtgcgactcatgttcacggcgtttcttccggacagcaccggcagcttcaca
cggcgcctggaacccgtggtgtcggacgccatctacgacagcaaagcccccaatgcctcc
aacttgaagattgtcaggatggataggacagctggatgcgtgactggaggggaagagatt
tatcttctctgtgacaaggttcagaaagatgacatccagatccgattttatgaagaggaa
gaaaatggtggaatctgggaaggatttggagatttttcccctacagacgttcatagacaa
tttgccattgtcttcaagactccgaagtataaagatgtcaacattacaaaaccggcctcc
gtgttcgtccagcttcggaggaaatctgacttggaaaccagtgaaccaaaaccttttctc
tactatcctgaaatcaaagataaagaggaagtgcagaggaagcggcagaagctcatgccc
aatttctcggatagtttcggcggcggcagtggggccggcgctggaggtggtggcatgttt
ggcggtggtggtggaggagggggtgctggaagcacaggtccagggtacggctttccgcac
tatggattccctacatatggtggcattaccttccaccctggagctgcgaaatccaatgct
gggatgaagcatggaaccatagacacctcgtgtaaaaatgaccctgaaggttgtgacgca
agtgatgacagagaggctgtaaatctctctgggaaaggaactgagaccacagcacgaaag
gagtctggcggcggggctgatgccattgctccagcgcccccagcgggagcagaggaaggg
cgctcctgctgtcaggataacctgtttctagagaaggctatgcagcttgccaagcggcac
gccaatgcccttttcgactacgcggtgacaggagatgtgaagatgctactggctgtccag
cgccatctcactgcagtgcaggatgagaatggggacagtgtcttacacttagcgatcatc
caccttcacgcccagcttgtgagggatctgctagaagtcacgtctggtttggtttctgat
gacattatcaacatgagaaatgacctctaccagacgcccttgcatttggcagtgatcacc
aagcaggaggctgtggtggaggacttgctgcgggccggggccgacctgagccttctggac
cgcttcggtaactctgctttgcacctagctgccaaagaaggacatgataaaattctcggt
attttactcaagcacaaaaaggcagcactacttatcaaccaccccaatgcggacggtctg
aatgccattcacatagccatgatgagcaacagcatgccgtgtctgcggctgctggtgact
gccggggcggacgtcaatgcccaggagcggaagtcggggcgcacggcgctgcacctggct
gtggagcgggacaacatctccctggccggctgcctgctcctggagggtgaagcccatgtt
gacagtaccacctacgatggaactacacccctgcacatagcggccgggagagggtctacc
cggctggccgctctcctcaaagcagcaggagcagaccccttggtggagaacttcgagcct
ctctacgacctggatgactcttgggaagagaatggagaggacgaaggagtggtgcctgga
accacacccctagacatggccaccagctggcaggtatttgacatattaaatgggaaaccc
tatgagcccgagtttacatcagatgatttactggcacaaggagacatgaaacagctgact
gaagatgcaaagttgcagctctacaagttgctagaaatccctgatccagacaaaaactgg
gccactctggcacagaaattaggtctggggatactaaataatgccttccggctgagtcct
gccccgtctaagactcttatggacaactacgaggtctctggggggacgataaaagagctg
gtggacgccctgagacagatgggctacacagaagcagttgaagtgatccaggcagcattc
tgcacctcaggaaccgcagcccccagcccagtgacgaccacctcccaggcccccttgctg
cctctcgcacctgcctccacaaggcagcaaatagacgagctccgggaggacagcgtctgt
gacagtggcgtggagacctccttccgcagactcagcttcacggagtctctgaccagcggc
agctcactgctaactcttaacaaaatgccccacgattacatgcaggaaggacctatagaa
gggaaaatttag

DBGET integrated database retrieval system