KEGG   Equus caballus (horse): 100057622Help
Entry
100057622         CDS       T01058                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00053  Ascorbate and aldarate metabolism
ecb00071  Fatty acid degradation
ecb00280  Valine, leucine and isoleucine degradation
ecb00310  Lysine degradation
ecb00330  Arginine and proline metabolism
ecb00340  Histidine metabolism
ecb00380  Tryptophan metabolism
ecb00410  beta-Alanine metabolism
ecb00561  Glycerolipid metabolism
ecb00620  Pyruvate metabolism
ecb01100  Metabolic pathways
Module
ecb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100057622 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100057622 (ALDH2)
   00620 Pyruvate metabolism
    100057622 (ALDH2)
  Lipid metabolism
   00071 Fatty acid degradation
    100057622 (ALDH2)
   00561 Glycerolipid metabolism
    100057622 (ALDH2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100057622 (ALDH2)
   00310 Lysine degradation
    100057622 (ALDH2)
   00330 Arginine and proline metabolism
    100057622 (ALDH2)
   00340 Histidine metabolism
    100057622 (ALDH2)
   00380 Tryptophan metabolism
    100057622 (ALDH2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100057622 (ALDH2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100057622 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100057622
NCBI-ProteinID: XP_005612652
Ensembl: ENSECAG00000017673
LinkDB All DBs
Position
8
AA seq 521 aa AA seqDB search
MLRAAALAAAGLGPRLGRRLLSAAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
VNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLTKEAGFPPGVVN
VVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGRSNLKKVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARARSRVVGNPFDSQT
EQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF
GAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggccgctgccctcgccgccgcaggcctcgggccccgcctgggccgccgcctc
ctctcggccgccgccacccaggccgtgccggcccccaaccagcagcccgaggtcttctac
aaccagatcttcataaacaatgagtggcacgacgctgtcagcaagaaaacattccccacc
gtcaatccgtctactggggaagtcatctgtcaggtagcagcaggcgacaaggaagatgtg
gacagggcagtgaaggctgcccgggctgcctttcagctgggctcgccctggcgccgcatg
gatgcatctgacaggggccggctgctgaaccgcttggctgatctgattgaacgggaccgg
acctacctggcagccttggagaccctggataatggcaagccctacgtcatctcttacctg
gtggatttggacatggtcctcaaatgtctccgttattatgctggctgggccgataagtac
catgggaaaaccattcccatcgatggggacttcttcagctacacccgccatgaacctgtg
ggggtgtgtgggcagatcattccgtggaacttcccactcttgatgcaagcatggaaactg
ggcccagccttggcgactggaaacgtggttgtgatgaaggtggccgagcagactccactc
actgccctctatgtggccaacttgactaaggaggctggctttccccctggcgtggtcaat
gttgttcctggatttggccccacggctggggctgccattgcctcccatgaggatgtggac
aaagtagctttcacaggctccactgaggttggccacctaatccaggttgctgcagggagg
agtaacctcaagaaagtgaccctggagctgggaggaaaaagccctaacatcatcatgtca
gatgctgacatggactgggcggtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgtgcgggctcccggacctttgtgcaggaggatgtttacgctgagtttgtg
gagcgcagcgttgcccgggcccggtctcgtgtggttgggaacccctttgacagccagacc
gagcaggggccacaggtggatgaaactcagtttaataaggtccttggctatatcaaatct
gggaaggaagagggggcgaagctgctgtgtggtggaggggcagctgctgaccgtggctac
ttcatccagcccactgtgttcggagatgtgcaagatggcatgacaatcgcaaaggaggag
atcttcgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcgtcgggaga
gccaacaattccaagtatgggctggccgcagctgtcttcacaaaggacttggacaaagcc
aattatctgtcccaagccctccaggctggcactgtgtggatcaactgctatgacgtgttt
ggggcccagtcaccatttggtggctacaagatgtctgggaacggccgggagctgggagag
tatggcctgcaggcatacaccgaggtgaaaactgtcacaatcaaagttcctcagaagaac
tcataa

DBGET integrated database retrieval system