KEGG   Equus caballus (horse): 100057774
Entry
100057774         CDS       T01058                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb00565  Ether lipid metabolism
ecb01100  Metabolic pathways
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04666  Fc gamma R-mediated phagocytosis
ecb04724  Glutamatergic synapse
ecb04912  GnRH signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05212  Pancreatic cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100057774 (PLD1)
   00565 Ether lipid metabolism
    100057774 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100057774 (PLD1)
   04072 Phospholipase D signaling pathway
    100057774 (PLD1)
   04071 Sphingolipid signaling pathway
    100057774 (PLD1)
   04024 cAMP signaling pathway
    100057774 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100057774 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100057774 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100057774 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100057774 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100057774 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057774 (PLD1)
   05231 Choline metabolism in cancer
    100057774 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100057774 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100057774 (PLD1)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100057774 (PLD1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100057774 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100057774 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 100057774
NCBI-ProteinID: NP_001296256
Ensembl: ENSECAG00000022638
VGNC: 21548
LinkDB
Position
19
AA seq 1074 aa
MSLKNEPRLNTSALRKIAADMSNLIENLDTRELHFEGEEVDCEVFPGDPKIQEVCIPFSA
VYNTQGFKEPDIQTYLSGCPIQARVLEVERFTSTTRVPSANLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPRDMPSLPRSSENMVREEQFFSRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIASVLLVDKEFRIKVGRKDTETKYGLRID
NLSRTLILKCNSYRHARWWAGAIEEFIQKHATNFLREHRFGSYAAIQENTLAKWYVNAKG
YFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDYVLKRKAQQGVRIFVMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDDEHRLTDVGSVKRVPVGLSLGSLTAETMESLESLTLKDKSESNKNVPILKN
GDDMDSKLKGIGKPRKFSKFSLYRQLHRHHLRNVDSISSVDSTSSYCNHCRSRQSLIHGL
KPHLKLFRSSSESEQGPSGPDVDTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASVVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHEWKYQVPGSVHANVQLLRSAADWSAGIKYHEESIHTAYVHVIENSKHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHREGQRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCF
RVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHSLIQLRDFI
SKPILAKEDPVRAEEELKKIRGFLVQFPFYFLSAESLLPSVGTKEAIVPTEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaagaatgagccgagactaaatacctcggcactgcggaaaatcgctgccgac
atgagtaatttgatagaaaatctggacacgcgggagctccactttgagggggaggaggtg
gattgcgaagtgtttcctggcgatcccaagatacaggaagtgtgcatccctttctctgcc
gtttataacactcaaggattcaaggagcctgatatacagacgtatctgtccggctgtccg
atacaagcccgagttctggaagtggagcgctttacgtctacaacgagggtaccaagtgcc
aatctttatactattgaattaacacatggagaatttaaatggcaagttaagcggaaattc
aagcactttcaagaatttcacagagagctgctcaagtacaaagccttcatccgaatcccc
attcccaccaggagacacacatttagaagacagaatgtcaaagaagagcctcgagacatg
ccaagtttgccccgttcatctgaaaacatggtcagagaagaacaattctttagcagaagg
aaacaactggaagattacttgacaaagttactaaaaatgcccatgtacagaaactatcat
gcaacaactgaattccttgatataagccagctgtctttcatccatgatctgggaccaaag
ggcatagaaggtatgataatgaagagatcagggggacacaggataccaggcttgaactgc
tgtggtcagggaagagcctgctaccgatggtcaaaaaggtggttgatagtgaaagattcc
tttttattgtatatgaagccagacagcggtgctattgcctccgtcctgctggtagataaa
gaattcagaattaaggtggggaggaaagacacagagacgaaatatggactccgaattgat
aatctttcaaggacacttattttaaaatgcaatagctatagacatgctcggtggtgggca
ggcgctatagaagaattcatccagaaacacgccaccaactttctcagagagcatcgattt
gggtcatacgctgctatccaagagaacactttagcgaaatggtatgttaatgccaaagga
tattttgaagatgtggccaatgcaatggaagaggccaaagaagagatttttatcacagat
tggtggttgagcccagaaatcttcctgaaacgcccagtggttgaaggaaatcggtggagg
ttggactacgtacttaaacgaaaagcacaacagggggtgaggatcttcgtaatgctctat
aaggaggtggaacttgctcttgggatcaatagtgaatacagcaagaggacgttaatgcgt
ctacaccccaacataaaggtgatgaggcacccggatcacgtgtcatccagtgtgtatctc
tgggctcatcatgagaaactcgtcatcatcgaccagtcggtggcctttgtgggtgggatc
gacctggcctatggaaggtgggatgatgatgagcacagactcacagacgtgggcagtgtg
aagcgtgtccccgtgggactgtctctgggttccctcacagctgaaacaatggaatctctg
gaatctttaacactcaaagataaaagtgaatctaataaaaatgtgcccatcctgaagaat
ggtgatgatatggattcaaaactgaaaggaataggaaagcccagaaagttctccaaattt
agcctctacaggcagctccacaggcaccacctgcgcaacgtggacagcatcagcagcgtc
gacagcacctccagttattgtaatcactgtagaagtcgtcagagtttaatccatggttta
aaaccccatttgaaactctttcgctcttccagtgagtctgagcaggggccctctggtccc
gacgttgacactggctccatccgcagtttacagacgggagtgggagagctccatggggaa
accagattctggcatggaaaggactactgcaattttgtcttcaaagactgggttcaactt
gataaaccctttgccgatttcatcgacaggtactccaccccccggatgccatggcatgac
attgcttctgtggtccatggaaaggcggctcgtgatgtggcacgtcactttatccagcgc
tggaacttcacgaagattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaaatctcaaacgacagcccatgagtggaaataccaagtgcccgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggcatcaagtaccatgaagag
tccatccacaccgcttacgtccatgtgatagagaacagcaagcactacatctatatagaa
aaccagtttttcataagctgtgctgatgacaaggtcgtgttcaacaagataggtgacgcc
atcgcccagaggatactgaaagctcacagggaaggccagaggtaccgggtgtatgttgtg
ataccccttctgccagggtttgaaggagacatttcaacgggtggaggaaacgctctacag
gcaatcatgcacttcaactacagaacgatgtgcagaggagaaaattccatccttggacag
ttaaaagcagaacttggcaatcagtggataaattacatatcattctgtggtcttagaaca
cacgcagagcttgaaggaaacctagtcactgagcttatctatgtccacagcaagttgcta
attgctgatgacaacactgtcattatcggctctgctaacataaatgaccgaagcatgctg
ggaaagcgggacagtgaaatggctgtcatcgtgcaggacacagagacggtcccttcagtg
atggatggagaggagtaccaagctggccggtttgcccagggccttcggctgcagtgtttc
agagttgtccttggctatctttcggacccaagtgaagacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacgatttatgataag
gtgttccggtgcctgcccaatgacgaagtacacagcttaattcaactgagagactttata
agcaaacccatattagccaaggaagatcccgtcagagcagaggaggaactgaaaaagatc
cgtgggttcttggtgcagttcccattttatttcttgtctgcagaaagcctactgccttct
gttggaaccaaagaagccatagtgcccacagaggtttggacttaa

KEGG   Equus caballus (horse): 100072863
Entry
100072863         CDS       T01058                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00564  Glycerophospholipid metabolism
ecb00565  Ether lipid metabolism
ecb01100  Metabolic pathways
ecb04014  Ras signaling pathway
ecb04024  cAMP signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04666  Fc gamma R-mediated phagocytosis
ecb04724  Glutamatergic synapse
ecb04912  GnRH signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05212  Pancreatic cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100072863 (PLD2)
   00565 Ether lipid metabolism
    100072863 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100072863 (PLD2)
   04072 Phospholipase D signaling pathway
    100072863 (PLD2)
   04071 Sphingolipid signaling pathway
    100072863 (PLD2)
   04024 cAMP signaling pathway
    100072863 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100072863 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100072863 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100072863 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    100072863 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100072863 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100072863 (PLD2)
   05231 Choline metabolism in cancer
    100072863 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100072863 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100072863 (PLD2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100072863 (PLD2)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100072863 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    100072863 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 100072863
NCBI-ProteinID: XP_023509133
Ensembl: ENSECAG00000014508
VGNC: 21549
LinkDB
Position
11
AA seq 944 aa
MMATPVSLFPSGDDLDSSQLQMEPDEVDTLREGEDPADRMHPFLAIYHLQPLKTHPLVFA
AGVPVTARVVGTERYTSGSKVGTCTLYSVQLTHGDFTWTTKKKFRHFHELHRDLLRHKVL
MSLLPLARFAIAHPPAREAANREMPSLPRAGPEGSARHASSKQKYLENYLNCLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGCKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGTISFVQLFDPGFEVQVGKRSTEVRYGVRIDTSHRSLILKCSSYRQAR
WWAQEISELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAREEIF
ITDWWLSPEMYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALGINSGYSKRVL
MLLHPNVKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSG
SAAPQPPTPCSDSSDTPDLSHNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVIHGPPARDLARHFIQRWNFTKTTKAKYKTPMYPYLLPKSTSTANQLPFMLPGMQ
CATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYSLHLPHWFFSLRT
LCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELCGHPVSELIYIHSKMLIADDRTVII
GSANINDRSLLGKRDSELAVLIEDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGAAAR
PDLDLRDPICDVFFQLWQDTAESNANIYEQIFRCLPSNATRSLRALREYVAVEPLATVCP
PLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGVMPLEVWT
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgatggcgacccccgtgagcctcttcccctctggggacgacctggactccagccagtta
cagatggagcccgatgaagtggacactctgagggagggagaggacccagctgaccggatg
cacccctttctggccatctaccacctccagcctctgaaaacgcaccccttggtgtttgcc
gctggggtccctgtcacagcccgggtggtgggcactgaaagatacaccagtggatccaag
gtaggaacctgcactctgtattctgtccaattgactcatggcgactttacctggacaacc
aagaagaaattccgtcatttccacgagctgcatcgagaccttctgagacacaaagtcttg
atgagtctgctccctctggctcgttttgccattgcccatcctccagcccgagaggcagcc
aacagagagatgccctctctcccccgagcaggtcctgaaggctctgccagacatgcatcc
agcaaacagaaatacctggagaattacctcaactgcctcctgaccatgtctttctaccgc
aactaccatgccatgacggagttcctggaagtcagtcagctgtcctttatcccggacctt
ggatgcaaaggactggagggggtgatccggaagcgctccggtggccaccgtgttcctggc
ctcacctgctgtggccgggaccaagtttgttaccgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagaccggcaccatctcatttgttcagctc
ttcgaccctggcttcgaggtgcaggtggggaaaaggagcacagaggtacggtacggggtc
cggatcgacacctcccacaggtccctgattctcaagtgcagcagctaccggcaggcgcgg
tggtgggcccaggagatctctgagctggcccagggcccgggcagagacttcctacagctg
caccggcatgacagctatgctcctcctcggcctgggactttggcccggtggttcgtgaat
ggggcaggttactttgctgctgtggcagatgccattcttcgagctcgagaggagattttc
atcacagactggtggttgagtcctgagatgtacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaagaaggcggaggagggtgtccgtgtgtccgtactg
ctgtttaaggaagtggagttggccttgggcatcaacagtggctatagcaagagggttctg
atgctgctgcaccccaacgtaaaggtgatgcgccacccagaccaggtgacgctgtgggcc
catcatgagaagctcctggtagtggaccaagtagtggccttcttgggggggctggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggggactcctctgga
tcagctgccccacagcctcccaccccgtgctcagactcttcagacaccccagacctctct
cacaaccaactcttctggctgggcaaggactacagcaatcttatcactaaggactgggtg
caactggaccggccttttgaggatttcattgacagggagaccacaccccgcatgccatgg
cgggacgttggggtggtcatccacggcccacccgcccgggaccttgcccgacacttcatc
cagcgctggaacttcaccaagactaccaaggccaagtacaagacacccatgtacccctac
ctgctgcccaagtccaccagcactgcaaaccagctccccttcatgctcccggggatgcag
tgcgccactgtgcaggtcttgcggtcagtggaccgctggtcagcggggactttggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcactttctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaagtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgcttccgggtctacgtgctt
ttgcccctgctccccgggtttgagggtgacatctccacaggtggtggtaactccatccag
gccattctgcacttcacttacagcctccacctccctcactggttcttttccctcaggact
ctgtgtcgtggggaatattcaatcctacatcgcctcaaagcagccatggggacagcatgg
cgggactatatatccatctgtgggcttcgtacacacggagagctgtgcgggcacccagtc
tcagagctcatctatatccacagcaagatgctcattgcggatgaccggacagtcatcatt
ggttctgcaaacatcaatgaccggagcttgctagggaagcgggacagtgagctggccgtg
ctgatcgaggacacagagatggagccatccctcatggacggcgtggagtatcaggcgggc
aggtttgccctgagtttgcggaagcattgcttcagtgtgattcttggggcagctgcccgg
ccagacctggatctccgagaccctatctgtgatgtcttcttccagttgtggcaagacaca
gcggagagcaatgccaatatctatgagcagatcttccgctgcctgccgtccaacgccaca
cgttccctgcgggcactccgggagtatgtggccgtggagcctctagccacggtctgccct
cctttggcacggtctgagctcacccaggtccagggacacctggtccacttccctctcaag
ttcctggaagatgagtctttgctgccccctctgggtagcaaggagggtgtgatgccccta
gaagtgtggacgtag

DBGET integrated database retrieval system