KEGG   Equus caballus (horse): 100057847Help
Entry
100057847         CDS       T01058                                 

Gene name
UQCRC2
Definition
(RefSeq) cytochrome b-c1 complex subunit 2, mitochondrial
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04260  Cardiac muscle contraction
ecb04714  Thermogenesis
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100057847 (UQCRC2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100057847 (UQCRC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100057847 (UQCRC2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100057847 (UQCRC2)
   05012 Parkinson disease
    100057847 (UQCRC2)
   05016 Huntington disease
    100057847 (UQCRC2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100057847 (UQCRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100057847 (UQCRC2)
Peptidases and inhibitors [BR:ecb01002]
 Metallo peptidases
  Family M16: pitrilysin family
   100057847 (UQCRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 100057847
NCBI-ProteinID: XP_001494431
Ensembl: ENSECAG00000021501
VGNC: 24818
UniProt: F6QA35
LinkDB All DBs
Position
13
AA seq 453 aa AA seqDB search
MKLLSRAGSLSRFYSLKVAPKVKATAAPAGVPPHPQDLEFTKLPNGLVIASLENYAPASR
IGLFIKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGTLSVTSTRENMA
YTVECLRDDIDILMEFLLNVTTSPEFRRWEVAALQSQLRIDKAVAFQNPQAHVIENLHAA
AYRNALANSLYCPDYRIGKVTPDELHHYVQNHFTSARMALVGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKARYRGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVK
RGSNATNSLYQAVAKGTNQPFDVSAFNASYSDSGLFGFYTISQSAAAGDVIKAAYNQVKK
IAQGNLSSADVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDSVA
DADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctaagcagagccgggtccctctcgagattttattctctcaaagttgctccc
aaagttaaagccacggctgcccccgcaggagtgcctccacatcctcaggaccttgagttt
accaaattaccaaatggtttagtgattgcttctctggaaaactatgctcctgcctcaaga
attggtttgttcattaaagcaggcagtagatacgaagactccaacaatttaggaacctct
catttgcttcgtcttgcatccagtttgactacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggtacattaagtgtgacttcaacaagggaaaacatggct
tacactgtggagtgcctgcgggacgacattgatattctaatggagttcttgctcaatgtt
accacgtcaccggagtttcgtcgttgggaggtagctgcccttcagtctcagctacggatt
gacaaagctgtggcttttcagaatccacaggctcatgtcattgaaaatttgcatgctgca
gcttaccgaaatgccttggctaattccttatattgtcctgattataggattggaaaagtg
acaccagatgagttacatcactacgttcagaaccattttacaagtgcaagaatggctttg
gttggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttatctggtgcaaaggccagataccgtggaggtgaaattcgagaa
cagaatggagacagtctcgtccatgctgctcttgtagcagaaagtgctgccataggaagt
gcagaagcaaatgcatttagtgttctccagcatgtcctcggtgctggaccacatgtcaag
aggggcagcaatgccaccaactctctataccaggctgttgccaagggaactaaccagcca
tttgatgtttctgcttttaatgcaagttactcggattctggactctttgggttttacacg
atctctcagtctgcagctgctggagatgttatcaaggctgcctataaccaagtaaaaaag
attgctcaaggaaacctttccagtgcagatgtccaggctgccaagaacaagctgaaagct
gggtacctaatgtcagtggagtcttctgagggtttcctggatgaagttgggtcccaggct
ctagctgctggttcgtacacgccgccatccacagtccttcagcagattgactcagtagct
gatgctgacatcataaatgctgcaaagaagtttgtttctggccagaagtcaatggcagca
agtggaaatttggggcatacgcctttcgttgatgagttataa

DBGET integrated database retrieval system