KEGG   Equus caballus (horse): 100058000
Entry
100058000         CDS       T01058                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04722  Neurotrophin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04926  Relaxin signaling pathway
ecb04931  Insulin resistance
ecb05132  Salmonella infection
ecb05134  Legionellosis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100058000 (NFKBIA)
   04668 TNF signaling pathway
    100058000 (NFKBIA)
   04024 cAMP signaling pathway
    100058000 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100058000 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100058000 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100058000 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100058000 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100058000 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100058000 (NFKBIA)
   04660 T cell receptor signaling pathway
    100058000 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100058000 (NFKBIA)
   04659 Th17 cell differentiation
    100058000 (NFKBIA)
   04657 IL-17 signaling pathway
    100058000 (NFKBIA)
   04662 B cell receptor signaling pathway
    100058000 (NFKBIA)
   04062 Chemokine signaling pathway
    100058000 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100058000 (NFKBIA)
   04926 Relaxin signaling pathway
    100058000 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100058000 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100058000 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058000 (NFKBIA)
   05203 Viral carcinogenesis
    100058000 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100058000 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100058000 (NFKBIA)
   05215 Prostate cancer
    100058000 (NFKBIA)
   05222 Small cell lung cancer
    100058000 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100058000 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058000 (NFKBIA)
   05135 Yersinia infection
    100058000 (NFKBIA)
   05134 Legionellosis
    100058000 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100058000 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100058000 (NFKBIA)
   05161 Hepatitis B
    100058000 (NFKBIA)
   05160 Hepatitis C
    100058000 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    100058000 (NFKBIA)
   05164 Influenza A
    100058000 (NFKBIA)
   05162 Measles
    100058000 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100058000 (NFKBIA)
   05163 Human cytomegalovirus infection
    100058000 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058000 (NFKBIA)
   05169 Epstein-Barr virus infection
    100058000 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100058000 (NFKBIA)
   05140 Leishmaniasis
    100058000 (NFKBIA)
   05142 Chagas disease
    100058000 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100058000 (NFKBIA)
   04131 Membrane trafficking [BR:ecb04131]
    100058000 (NFKBIA)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100058000 (NFKBIA)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100058000 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100058000
NCBI-ProteinID: XP_023479790
VGNC: 51608
LinkDB
Position
1
AA seq 314 aa
MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAKALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSYGTPHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagcccgccgagcccggccaggagtgggccatggagggcccgcgggacgcgctc
aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaggcgccg
cggggcgccgaaccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccacgaagagaaggccctgaccatggaggtggtccgccaagtgaagggagac
ctggcgttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctaaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg
ggagtcctgactcagtcctacggaaccccgcacctccattccatcctgcaggccactaac
tacaacggccacacgtgtctgcacctagcctctatccacggctacctgggcatcgtggag
cttctggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgcc
ctccatctcgctgtggacctgcagaatcctgacctggtgtcgctcttgttgaaatgtggg
gctgacgtcaacagagtcacctaccagggctactccccgtaccagcttacctggggccgc
ccgagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg
ccagagagcgaggatgaggagagctatgacacggagtcagagttcacggaggacgagctg
ccctatgatgactgtgtgcttggaggacagcgcctgacgctatga

DBGET integrated database retrieval system