KEGG   Equus caballus (horse): 100058139
Entry
100058139         CDS       T01058                                 

Gene name
VHL
Definition
(RefSeq) von Hippel-Lindau disease tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100058139 (VHL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100058139 (VHL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058139 (VHL)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100058139 (VHL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100058139 (VHL)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     100058139 (VHL)
SSDB
Motif
Pfam: VHL VHL_C Arm_vescicular Rcd1
Other DBs
NCBI-GeneID: 100058139
NCBI-ProteinID: XP_023475744
LinkDB
Position
16
AA seq 210 aa
MPRKAGRVEEAEEDGTEEDGREEAGAEESGPEESDPEEPGASEEMEAGRPRPVLRSVNSR
EPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLQPGTGRRIHSYRGHLWLFRDAGTYDGLL
VNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLE
DHPNVRKDLERLTQEHIENQQVEEETEDFN
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccccggaaggcggggcgggtggaagaggccgaggaggacggcactgaagaggacggc
cgcgaggaggctggcgccgaggagtccggcccggaagagtcggacccggaggagcctggc
gcctcggaggagatggaggccgggcggccgcggccggtgctgcgctcggtgaactcgcgc
gagccgtcccaggtcatcttctgcaaccgcagcccgcgcgtcgtgctgcccgtgtggctc
aacttcgacggcgagccgcagccctacccgacgctgcagcccggcaccggccgccgcatc
cacagctaccgaggtcacctttggctcttccgagatgcagggacatacgatgggctgctg
gttaaccagactgaactctttgtgccatctctcaatgttgatggacagcctatctttgcc
aacatcacactgccagtatacaccctgaaagagcgatgcctccaggttgtccggagctta
gtcaagcctgagaattacaggcgcctggacatcgtgagatcgctctacgaagatctggaa
gaccacccgaatgtgaggaaagacctggagcggctgacgcaggagcacattgaaaatcag
caggtggaagaggagactgaagattttaactga

DBGET integrated database retrieval system