KEGG   Equus caballus (horse): 100058188
Entry
100058188         CDS       T01058                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04062  Chemokine signaling pathway
ecb04144  Endocytosis
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04530  Tight junction
ecb04660  T cell receptor signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04912  GnRH signaling pathway
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100058188 (CDC42)
   04014 Ras signaling pathway
    100058188 (CDC42)
   04015 Rap1 signaling pathway
    100058188 (CDC42)
   04370 VEGF signaling pathway
    100058188 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100058188 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100058188 (CDC42)
   04520 Adherens junction
    100058188 (CDC42)
   04530 Tight junction
    100058188 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100058188 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100058188 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    100058188 (CDC42)
   04670 Leukocyte transendothelial migration
    100058188 (CDC42)
   04062 Chemokine signaling pathway
    100058188 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100058188 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100058188 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    100058188 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058188 (CDC42)
   05205 Proteoglycans in cancer
    100058188 (CDC42)
   05203 Viral carcinogenesis
    100058188 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100058188 (CDC42)
   05211 Renal cell carcinoma
    100058188 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100058188 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100058188 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058188 (CDC42)
   05135 Yersinia infection
    100058188 (CDC42)
   05100 Bacterial invasion of epithelial cells
    100058188 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100058188 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100058188 (CDC42)
   03036 Chromosome and associated proteins [BR:ecb03036]
    100058188 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100058188 (CDC42)
   04031 GTP-binding proteins [BR:ecb04031]
    100058188 (CDC42)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100058188 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    100058188 (CDC42)
  Macropinocytosis
   Ras GTPases
    100058188 (CDC42)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100058188 (CDC42)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100058188 (CDC42)
  Exosomal proteins of breast milk
   100058188 (CDC42)
GTP-binding proteins [BR:ecb04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100058188 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 100058188
NCBI-ProteinID: NP_001296338
Ensembl: ENSECAG00000019180
UniProt: K9K202
LinkDB
Position
2
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaataagtttccatctgagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtgtttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcccatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system