KEGG   Equus caballus (horse): 100058204
Entry
100058204         CDS       T01058                                 

Gene name
PRCC
Definition
(RefSeq) proline-rich protein PRCC isoform X1
  KO
K13105  proline-rich protein PRCC
Organism
ecb  Equus caballus (horse)
Pathway
ecb05202  Transcriptional misregulation in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100058204 (PRCC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100058204 (PRCC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ecb03041]
    100058204 (PRCC)
Spliceosome [BR:ecb03041]
 Complex B
  Other components
   Prp19-related factors
    100058204 (PRCC)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 100058204
NCBI-ProteinID: XP_023496744
LinkDB
Position
5
AA seq 494 aa
MSLVAYASSDESEPDEAEPEPEEEEAAAPTSGPTLGGLFASLPAPKGPALLPPPPQMLAP
AFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGL
SLPTPIGGAGPPLGLPKPKKRTEPVKIAAPELHKGDSDSEEDEPTKKKTVLQGSGEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDGSSDTKPSRQASKTKPSSLAPVVGTTTTTP
SPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPDKAEPPGVEPYPYPIPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAQDPALVPTQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKHLLPMVLEYAPSLTDTAAAFQNFAAFCPPSGWWSLVAEV
ERLEQFPVLHLEAL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtcgctggttgcttacgccagcagcgatgagagtgagccagatgaggctgagccggag
ccggaggaggaggaggcggcggcccctacatctgggcccactttagggggcttgttcgct
tctctccccgcacccaagggtccggccttgctgcctccgcccccccagatgctggcccca
gcctttcccccgccgctgttgctgcccccacccaccggagacccccggctccagcctcct
ccccccttgcccttcggcctgggaggcttccccccacctccaggcgtgagcccagctgaa
gcggcgggagttggggaggggctgggattggggctgccctcgccccgaggccctggcctg
agcctgcccacccctatcggcggtgccgggccccccctggggcttcccaagccaaagaag
aggacagagcccgtgaagatagcggcgccggagctgcataagggggattcagattctgag
gaagatgaacccacaaagaagaaaactgtccttcagggatctggtgaggggactggtttg
tctgccttgcttccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctg
ccccatgccttctcccggaaaccctcggatggctcctctgacactaagccctccagacag
gcttctaagaccaagccctcctctcttgcccctgttgtgggcaccacaaccaccactccg
tcaccctctgccatcaaggctgctgccaagagtgctgccctgcaggtgacgaagcaaatc
acacaggaggaggacgacagtgatgaggaagtcgcccccgagaactttttctccctccct
gacaaggccgagccacctggagttgagccatacccttaccccatccccaccgtccctgaa
gagctgcctccaggcacggaaccagagccggccttccaggacgatgcagccaatgccccc
cttgaattcaagatggcagcaggctcaagtggggccccttggatgcctaagcctggggac
gactacagctacaatcagttttccacatatggcgatgccaatgccgctggtgcttattat
caggattattacagtggtggctactatcctgcacaggacccggccctggtccccacccag
gaaattgccccagatgcctccttcatcgatgacgaagcatttaagcggctgcagggcaag
aggaaccgaggaagggaggagatcaactttgtggagatcaaaggtgatgaccagctcagt
ggggcccagcagtggatgaccaagtctttgacagaagagaaaaccatgaagtcattcagc
aaacacctgttgccaatggtactggagtatgcaccgagcctcacagatacagctgctgcc
ttccagaactttgcagcattttgccctccatctggatggtggagtctggttgctgaggtt
gaacggttggagcagtttcctgtcctgcacctggaagctctctga

DBGET integrated database retrieval system