KEGG   Equus caballus (horse): 100058245
Entry
100058245         CDS       T01058                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X12
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01522  Endocrine resistance
ecb04012  ErbB signaling pathway
ecb04062  Chemokine signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04510  Focal adhesion
ecb04670  Leukocyte transendothelial migration
ecb04810  Regulation of actin cytoskeleton
ecb04935  Growth hormone synthesis, secretion and action
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05146  Amoebiasis
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05205  Proteoglycans in cancer
ecb05222  Small cell lung cancer
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100058245 (PTK2)
   04370 VEGF signaling pathway
    100058245 (PTK2)
   04151 PI3K-Akt signaling pathway
    100058245 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100058245 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100058245 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100058245 (PTK2)
   04062 Chemokine signaling pathway
    100058245 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100058245 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    100058245 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058245 (PTK2)
   05202 Transcriptional misregulation in cancer
    100058245 (PTK2)
   05205 Proteoglycans in cancer
    100058245 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100058245 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100058245 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100058245 (PTK2)
   05100 Bacterial invasion of epithelial cells
    100058245 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100058245 (PTK2)
   05163 Human cytomegalovirus infection
    100058245 (PTK2)
   05165 Human papillomavirus infection
    100058245 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100058245 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100058245 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100058245 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100058245 (PTK2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100058245 (PTK2)
Protein kinases [BR:ecb01001]
 Non-receptor tyrosine kinases
  FAK family
   100058245 (PTK2)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100058245 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100058245
NCBI-ProteinID: XP_005613371
Ensembl: ENSECAG00000014150
VGNC: 22002
LinkDB
Position
9
AA seq 983 aa
METLLMSGYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGC
LEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFAN
LNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHL
ADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNG
ATQSFIIRPQKEGERALPSIPKLANSERQGVRTHAVSVSGVSHCQHKVKKARRFLPLVFC
SLEPPSTDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQ
FGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITE
NPVWIIMELCTLGELRSFLQVRKYNLDLASLILYAYQLSTALAYLESKRFVHRDIAARNV
LVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCM
WEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTEL
KAQLSTILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPS
PQHMVQTNHYQVSGYPGSHGVTAVAGSIYPAQASLLDQTDSWNHRPQEISMWQPNVEDSA
ALDLRGIGQVLPAHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQ
GPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEI
SPPPTANLDRSNDRVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVD
ETIPVLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAV
DAKNLLDVIDQARLRMLGQTRPH
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggagacgctactgatgtcaggatatgaattgagaattcgctatttgccaaaaggattt
ctaaaccagtttactgaagacaagccaactctgaatttcttctatcaacaggtgaagagt
gattatatgttagagatagctgatcaagtggaccaggacattgctttgaagttgggttgt
ctagaaatacggcgatcgtactgggagatgcggggcaatgcactggagaagaagtctaac
tatgaagtgttagaaaaagatgttggtttgaagcggttttttcctaggagtttactggat
tctgtcaaggccaaaacactcagaaaactgatccaacaaacatttagacagtttgccaac
cttaacagagaagaaagtattctgaaattctttgagatcctctccccagtgtacagattt
gataaagaatgcttcaagtgtgctcttggttcaagctggattatttcagtggaactggca
atcggcccggaagaaggcatcagttacctcacggacaagggctgcaacccgacacatctg
gccgacttcaaccaagtgcagaccattcagtattcaaacagcgaggacaaggacaggaaa
ggaatgctgcaactgaaaatagcaggcgcacccgagcctctgacagtgacagcgccatcc
ctcaccatcgcagagaatatggctgacttgatagatggatattgccggctggtgaatgga
gccacgcagtcttttatcatcagaccccagaaagaaggcgaacgggctttgccgtcaata
ccaaagctggccaacagcgagaggcaaggtgtgcggacacacgccgtctccgtgtcagga
gtcagtcactgccagcataaagttaagaaagctaggcgctttctccctttggtcttctgt
tcccttgagcctccttctacggatgaaattagtggggacgaaacagatgattatgctgag
attatagacgaagaagatacttacaccatgccctcaaaaagctatggaatagatgaagct
agggattatgagattcaaagagaaagaatagaacttggacggtgtattggagaaggccaa
tttggagatgtgcaccaaggcgtttatctgagcccagagaatccagctttggcggttgca
attaaaacatgtaaaaactgtacttcggacagcgtgagagagaaattccttcaagaagcc
ttaacgatgcgtcagtttgaccacccgcatattgtgaagctgattggagtcatcacagag
aaccctgtctggatcatcatggagctgtgcacccttggagagctgaggtcatttctacaa
gtaaggaaatacaatttggatctggcgtctttgatcctgtatgcctaccagctaagtaca
gcgctcgcctatctggagagcaaacgctttgtgcacagggacattgctgctcggaatgtt
ctggtgtcctcaaatgattgcgtgaagttaggggactttggattatcccgatacatggaa
gacagcacttactacaaagcttccaaaggaaaattgcctattaaatggatggctccagag
tcaatcaattttcgacgttttacctcagctagtgatgtatggatgtttggtgtatgtatg
tgggagatactgatgcatggtgtgaagccttttcaaggagtgaagaacaatgatgtgatc
ggtcgaattgagaatggggaaagattaccaatgcctccaaattgccctcctaccctctac
agccttatgacgaaatgctgggcctatgaccccagcagacggccccgattcactgagctc
aaagctcagctcagcacaatcctggaagaggagaaggttcagcaagaagaacggatgagg
atggagtccagaagacaggtcacagtgtcctgggactccggagggtccgacgaagcacca
cccaagcccagcagacctggttatcctagtccaaggtccagcgaaggattttaccccagc
ccacagcacatggtgcaaaccaatcattaccaggtctctggctaccctggttcacatgga
gtgacagccgtggctggcagcatctacccagctcaggcatctcttttggaccaaacagat
tcatggaatcatagaccacaggagatatcaatgtggcaacccaacgtggaggactcagcg
gctctggacctgcgaggaatcgggcaggtgttgccggcccacctgatggaagagcggctc
atccgacagcagcaggagatggaagaagatcaacgctggctggaaaaagaggagagattt
ttgaaacctgacgtgcggctctctcgaggcagcattgacagggaggatggaagtcttcag
ggcccgactggaaaccaacacatttatcagcctgtgggtaaaccagatcctgcggctccg
ccaaagaaaccaccgcgccccggagcccccggtcacctgggcagcctcgccagtctcagc
agccccggggacagttacaacgagggtgtcaagccgtggaggcttcaaccccaggaaatc
agcccgcctcccaccgccaacctggaccgctccaatgacagggtgtacgagaacgtgacg
ggcctggtgaaagctgtcatcgagatgtccagtaagatccagcccgccccaccagaggag
tatgttcccatggtgaaggaagtcggcttggccctgaggacgttactggccactgtggat
gagaccattcccgtcctgccagccagcactcaccgagagattgagatggcccagaagctc
ttgaactccgacctgggcgagctcatcaacaagatgaagctggcacagcagtacgtcatg
accagcctccagcaggagtacaaaaagcaaatgctgactgccgcgcacgccctggccgtg
gatgccaagaacttgctcgatgtcatcgaccaggcgagactgagaatgctcgggcagacg
aggccgcactga

DBGET integrated database retrieval system