KEGG   Equus caballus (horse): 100058402Help
Entry
100058402         CDS       T01058                                 

Gene name
NDUFB5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100058402 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100058402 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100058402 (NDUFB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100058402 (NDUFB5)
   05012 Parkinson disease
    100058402 (NDUFB5)
   05016 Huntington disease
    100058402 (NDUFB5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100058402 (NDUFB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B5 PanZ
Motif
Other DBs
NCBI-GeneID: 100058402
NCBI-ProteinID: XP_001495558
Ensembl: ENSECAG00000000682
VGNC: 20641
UniProt: F7CB31
LinkDB All DBs
Position
19
AA seq 188 aa AA seqDB search
MAAMSLLQRASVAAASLCGRRLGPRHAFGGFLTRGFPKTVAPVRHSGGHGKRLFIIKPSG
FYDRRFLNLMRFYILLTGIPVAIGITLINVFIGEAELAEIPEGYIPEHWEYFKHPISRWI
ARTFFDSPEKNYEKTLAILQIEAEKADLRLKELEVRKLMRARGDGPWYQYPTIDKALIDH
SPKAAPDN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatgagtttgttgcagcgagcttcggtcgctgcggcctctctgtgtggccgc
cgccttggccctcgacatgcattcgggggcttcctcacccgtggctttccgaagactgtc
gctcctgtgcgacacagtggaggccatgggaaaagactgtttatcatcaaaccttctgga
ttctatgacaggcgttttttgaatttaatgagattttacattttgttgactgggattcca
gtagcaattggcataactctgataaatgtattcattggtgaagctgagttagcagaaatt
ccagaaggctatatcccagaacactgggaatatttcaagcatcctatatcaaggtggatt
gcccgaactttctttgatagtcctgaaaagaattatgaaaaaacattggctatccttcag
attgaagctgaaaaggctgacttacggttaaaggagctggaagtacgaaaattaatgcgt
gcgagaggtgatggtccctggtatcagtatccgaccattgataaggcgcttatcgatcat
tctccaaaagcagctcccgacaactaa

DBGET integrated database retrieval system