KEGG   Equus caballus (horse): 100058432
Entry
100058432         CDS       T01058                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ecb  Equus caballus (horse)
Pathway
ecb01523  Antifolate resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04062  Chemokine signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04380  Osteoclast differentiation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04622  RIG-I-like receptor signaling pathway
ecb04623  Cytosolic DNA-sensing pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04668  TNF signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05162  Measles
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05168  Herpes simplex virus 1 infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05212  Pancreatic cancer
ecb05215  Prostate cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05222  Small cell lung cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05340  Primary immunodeficiency
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100058432 (IKBKG)
   04014 Ras signaling pathway
    100058432 (IKBKG)
   04064 NF-kappa B signaling pathway
    100058432 (IKBKG)
   04668 TNF signaling pathway
    100058432 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100058432 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100058432 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100058432 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100058432 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100058432 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100058432 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100058432 (IKBKG)
   04660 T cell receptor signaling pathway
    100058432 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100058432 (IKBKG)
   04659 Th17 cell differentiation
    100058432 (IKBKG)
   04657 IL-17 signaling pathway
    100058432 (IKBKG)
   04662 B cell receptor signaling pathway
    100058432 (IKBKG)
   04062 Chemokine signaling pathway
    100058432 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100058432 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100058432 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100058432 (IKBKG)
   05203 Viral carcinogenesis
    100058432 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100058432 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100058432 (IKBKG)
   05221 Acute myeloid leukemia
    100058432 (IKBKG)
   05220 Chronic myeloid leukemia
    100058432 (IKBKG)
   05215 Prostate cancer
    100058432 (IKBKG)
   05222 Small cell lung cancer
    100058432 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100058432 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100058432 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100058432 (IKBKG)
   05135 Yersinia infection
    100058432 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100058432 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100058432 (IKBKG)
   05162 Measles
    100058432 (IKBKG)
   05164 Influenza A
    100058432 (IKBKG)
   05161 Hepatitis B
    100058432 (IKBKG)
   05160 Hepatitis C
    100058432 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100058432 (IKBKG)
   05163 Human cytomegalovirus infection
    100058432 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100058432 (IKBKG)
   05169 Epstein-Barr virus infection
    100058432 (IKBKG)
   05165 Human papillomavirus infection
    100058432 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100058432 (IKBKG)
   05142 Chagas disease
    100058432 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100058432 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100058432 (IKBKG)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100058432 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Filament
Other DBs
NCBI-GeneID: 100058432
NCBI-ProteinID: NP_001271462
Ensembl: ENSECAG00000020595
VGNC: 18986
UniProt: F6TK31
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQHFQSSQREEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALKEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALQQQHNVQVDQLRMQTQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSMVSSERNRGMQLEDLKQQLQQAEEALVAKQEAIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKECLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPLPPTPAHHSIHSALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtacagcctagtggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccggccatgctccac
ctgccttcggagcagggaactcctgagaccttccagcgttgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
catttccagagcagccagagggaggagaaggagttcctcatgcagaaattccaggaggcc
agaaaactggtggagagactgagcctggagaagcttgacctgaggaggcagcgggaacag
gccctgaaggaggtggaacacctgaagagatgccagcagcagatggccgaggataaggcc
tcagtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg
gaggccgccactaaggagcggcaggctctggagggcagggcccgggcggccagtgagcag
gcccggcagctggagagtgagcgggaggcgctgcagcagcagcacaacgtgcaggtggac
cagctgcgcatgcagacccagagcatggaggctgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctacaggtagcctatcaccagctcttccaagag
tatgacaaccacatcaagagcagcatggtgagcagtgagcggaaccgaggaatgcagctg
gaagatcttaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagcg
attgacaagctcaaggaagaggccgagcagcataagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggcggaaaggcaggcccgggag
aagctggctgagaaaaaggagtgtctgcaggagcagctggagcagctgcagagggagtac
agccggttgaaggccagctgtcaggagtcagccaggatcgaagatatgaggaagcggcat
gtagaggtctcccagccccccttaccccccaccccagctcaccactccattcactcggcc
ctgcccagccagaggagaagtccccccgaggagccacccgacttctgttgccccaagtgc
cagtaccaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system