KEGG   Equus caballus (horse): 100058498Help
Entry
100058498         CDS       T01058                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05164  Influenza A
ecb05202  Transcriptional misregulation in cancer
ecb05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100058498 (TMPRSS2)
   05215 Prostate cancer
    100058498 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    100058498 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecb01002]
    100058498 (TMPRSS2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100058498 (TMPRSS2)
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100058498 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 100058498
NCBI-ProteinID: XP_005606217
Ensembl: ENSECAG00000022289
VGNC: 24341
LinkDB All DBs
Position
26
AA seq 490 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPESFYSRQPPVAPGAYGAYEAEYYPPTVPRYSPRVLTQA
STPVNHTQPKLLSETVCTLKTKKVLCILLSLGLLLVVLVVAAILLWKFVENKCMGSRIEC
GNSGICTSASQWCDGILHCPNGEDENRCVRLYGLNFILQVYSSQRKSWHPVCEDDWSESY
GRAVCRDMGYGNSFYSSQGIKDDSGATRFMKLNTSADNIDLYKKLYHSDVCSSKKVVSLR
CMECGVSSKQQSRIVGGANAALGEWPWQVSLHVQDVHVCGGSIITPEWIVTAAHCVEPPL
NSPRYWTAFAGILSQSLMFYENGHRVGKVIAHPNYDSKTKNNDIALMKLEAPLTFNDRVK
PVCLPNPGMRLEPKQSCWISGWGATYEKGKTSELLNAAMVPLIEPEQCNNKFIYNDLITP
AMICAGYLEGKVDSCQGDSGGPLVTLKSSIWWLIGDTSWGSGCAKMNRPGVYGNVTVFTD
WIYQEMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccttaaactcaggatcaccaccaggtgttggaccttactacgaaaaccatggatac
caaccagaaagcttctattcccggcagccccctgtggcccctggtgcctacggagcgtat
gaggccgagtactacccacccacggtaccccggtactccccgagggttctgacgcaggct
tcgacacccgtcaaccacacgcagcccaaactcttatcggagacagtgtgcaccttgaag
actaagaaagtgctgtgcatcctcctcagcctggggctcctgctcgtggtgctcgtggtg
gccgccatcctgctctggaagttcgtggagaacaagtgcatggggtcccggatagagtgt
ggcaactcaggaatctgcaccagcgcctcccagtggtgcgacgggatcctgcactgcccc
aacggggaggacgagaaccggtgtgttcgcctgtatggactgaacttcatcctccaggtg
tactcgtcccagaggaagtcctggcaccccgtgtgtgaagacgactggagcgagagctat
gggagagccgtgtgccgtgacatgggctatgggaatagtttttattccagccaaggaata
aaggatgacagcggggccacaagatttatgaagctgaacacaagtgccgacaatatcgat
ctctataaaaaactgtaccatagtgatgtctgttcttcaaaaaaagtggtttctttacgc
tgtatggagtgcggggtctcctcgaaacaacagagccggattgtgggcggggcgaacgcg
gccctgggggagtggccctggcaggtcagtctgcacgtccaggatgtccacgtctgcgga
ggctccatcatcacccccgagtggatcgtgaccgccgcccactgcgtggagccgccgctt
aacagcccccggtactggacagccttcgcaggcattttgagccaatctttaatgttctac
gaaaatggacaccgagtgggaaaagtgattgctcatccgaattacgattccaagaccaag
aacaatgacattgctctgatgaagcttgaggcccctctgacttttaacgacagagtgaaa
ccagtgtgtctgccgaacccgggcatgaggctggagccgaaacagtcctgctggatctcc
gggtggggcgccacctacgagaaagggaaaacctcagagctgctgaacgccgccatggtc
cccctgatcgagcccgagcaatgcaacaacaagttcatctacaacgatctcatcacgccc
gccatgatctgcgccgggtatctggaggggaaagtcgattcctgccagggtgacagtgga
ggtcctctggtcactctgaagagtagcatctggtggctgattggggacacgagctgggga
tccggatgtgccaagatgaacagaccgggagtgtacgggaacgtgacagtgttcacagac
tggatctaccaagagatgagggcgaacagctaa

DBGET integrated database retrieval system