KEGG   Equus caballus (horse): 100058932Help
Entry
100058932         CDS       T01058                                 

Gene name
KMT2D
Definition
(RefSeq) histone-lysine N-methyltransferase 2D isoform X1
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00310  Lysine degradation
ecb04934  Cushing's syndrome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100058932 (KMT2D)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100058932 (KMT2D)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100058932 (KMT2D)
Transcription factors [BR:ecb03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100058932 (KMT2D)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100058932 (KMT2D)
   HMT complexes
    MLL-HCF complex
     100058932 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 100058932
NCBI-ProteinID: XP_005611196
LinkDB All DBs
Position
6
AA seq 5561 aa AA seqDB search
MDSQKPPGEDKDSESAADGPAASEESGATEPDLPNPHVGEVSVPSSGGPRVQEPLQDCSG
GPPRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGNPGPSEAALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGASSAELNPNSEWFENYSLCHRCHKAQGGQPISS
VAEQHPPVCSRFLPPEPGDTPTDEPDALYVACHGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPQESPPSPPLETPLSPPPETSPLSPPLEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPMSPPPEVSRLLPLPELSRLSPPPEESPLSPPPEES
PTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPEDLLMSLPLEESPLSPLSEEPQLCPRP
EELRLSPGSEGRHLSPASEGPCLSPRPEEPRLSPRPEEPCLSPRPEEPRLSPRPEEPCLS
PAPEELHLSPQPEEPPLSPQREELHPSPQPEEPPLSPRPEELRLSPHPEELRLSPHPEEL
RLSPHPEELRLSPHPEELRLSPRPEETHLSPQPEEPCLSPRPEEHPEQPGLCPAPEELPL
FLPPGEPPLSPLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPI
ITAVAPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILP
PSPGSPMGLASPVLMEPLPPQCSPLLQDSLPPQNSLPSQCSPALPLSLPSPLSPMEKAVE
VSEEAEPHEMETEKVPEPECPALEPSPTSPLSSPMGNLSCPAPSPAPALDDFSGLGEDIA
PLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDPEELAPVTPMEVYGPECKQAGQGSPCE
EQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELG
VSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGGGKAEGDKGRRRSSPARSRIKQG
RSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSVETLVVADIDSSPSKEEEDDDDDTMQNT
VVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWR
CVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAA
SPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDV
EQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNL
TMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDGDLDTDELLKGEGAVEHMECE
IKLEGPISPDGEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSG
DGQPDEVMPADLPAEGSVDQSLADGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLD
LSRKALFAVGVGRPSFALGTPKAKGDGGSDKKELPTSQKGDDGPDVADEESRGPEGKPDT
PGPEDGGVKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKDVQQLFKDVLGSER
EQHLGCGTPGLDGSRTPLQRPFLQGGLSLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFS
PEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLY
ANMNFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQ
INKQTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFL
KPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPTYALDPRFPTAPPTYPPYPSPT
GAPAQPSTLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGV
GGGKASEPLLSPPPFGETRKALEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGGLELKA
PDVFKAPLTPRASQVEPQSPGLGLRPQEPAPAQALAPSPPSHSDIFRPGPYPDPYAQPPL
TPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPR
FQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGPLAHTPLGAGGFPAALPSGPA
GELHAKVPGGQPPNFARSPGTGAFVGTPSSMRFTFPQAVGEPSLKPPVPQPGLPPPHGIN
SHFGPGPTLGKPQSTNFTVATGNFHPSGSPLGPSTGSTGEGYGLSPLRPPSVLPPSAPDG
SLPYLSHGASQRAGITSPVDKREDPGAGMGSSLAAPELPGTQDPGMSSLSQTELEKQRQR
QRLRELLIRQQIQRNTLRQEKETAAAAAGAVGTPGSWGAEPSSPAFEQLSRGQTPFTGTQ
DKNSLVGLPPGKLGGPILGPGAFPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAP
YPGSLPLQQQQQQQLWQQQQQQQQATAATSMRLAMSARFPSAPGPELGRQALGSPLAGIP
TRLPGPGEPLPGPAGPAQFIELRHNVQKGLGPGGAPFPGQGPPQRPRFYPVNEDSHRLPP
EGLRGLAVSGLPPQKPSAPPAPELNNSLHPTPHTKVPTLPPGLELVSRPPSSSELGRPPP
LALEAGKLSCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHL
DDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEE
RPPPAADASETRLASVLPEVKPKVEEGGRHPSPCQFTITTPKVEPAPATPSLGLGLKPGQ
SVMGSRDTRMGTGPFSSSGHTTEKGPFGATGGPPSHLLTPSPLSGPGGSSLLEKFELESG
TLTLPGGHAASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQQQ
QQQQQQQHSLLATPGPTQAMSLPHEGSSPSLAAPQQQLALGLGGSRQPGLAQPLMPTQPP
AHALQQRLAPSMTMVSNQGHMLSGQHGGQAGLVPQQSPQPVLTQKPMSTMPPSMCMKPQQ
LAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQV
SLLAQRLSGGPGSDLQNHVAAGSGQERSAGDPSQPRPNPPTFAQGVINEADQRQYEEWLF
HTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQ
KQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLP
GHGLQPPQGPPGGQAGGLRLPPGGMALPGQPGGPFLNTTLAQQQQQQHSGGAGALAGPSG
GFFPGNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQQQQQQQHLLGQVAIQQQ
QQQGPGVQANPALGPKPQGLLPPSSHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQQQQ
QQQQHHPGVLGPQGPHRQVLLNQSRVLSSPQLAQQGQGLTGHRLVTAQQQQQQHQQQGSV
AGLSHLQQGLMPHSGQPKLSAQPMGSLQQQQLQQQQLQQQQQQLQQQQQQLQQQQQQLQQ
QQQQQQQQQQQQLQQQQLQQQQFQQQQQQQMGLLNQSRTLLSPQQQQQQQQQQQQQVTLG
PGMPAKPLQRFSSPGALGPTLLLTGKEQSIVETALPPEATEGPSTHQGGPLAVATVPESV
ATEPGEVKPSLSGDAPLLLVQPQAQPQPNSVQLQPPLRLPGQQQQQVNLLHTAGAGSHGQ
PTSGSSSEASPLPHLLAQSSVSLGEQPGPMTQNLPGSQQPLGLERPMQNNAGSQPAKPGS
APQSGQGLPGTGLMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAV
RQTPPYQDPGTQPSPLQGLLGRQPHLGGFPGSQTGPLQELGAGLRPQGAPRLPTPQGALS
TGPVLGPVHPTPTPSSPQEPKRPSSQLPSPSSQLPSEAQLTPIQPGTPKPQGPPLELPPG
KVSPASAQLADAFFGKGVGPWDPPDNLAEAHKPEQSSLVPGHLEQVNGQVAPEPPHLSIK
QEPREEPCALGTQAVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLST
GQGPEGLRAEINGHIDSKLAGLEQKLQGTTSNKEDTAARKPLTPKPKRVQKASDRLVSSR
KKLRKEDGVRASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPINGQCQLRGAFG
SGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTASEELGEHPKDAA
SARDTEGTLRDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILG
EEAPRFPQLGSGRWEQDDRALSPVIPIIPRASIPVFPDTKPYGSLDLEAPGKLPATTWEK
GKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNNYEVLLPESPARAGIEPKKGEAE
GPGGKDKGLGGKSPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTY
NVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPATEPLVELPAEPSAEPPVPSPLPLASSP
ESARPKPRARPSEEGEDSRTPRLKKWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQL
GTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGA
LMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMH
KIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQM
ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFT
DASPQAVWNRIIEPVAAMRKEADMLRLFPKYLKGEELFGLTVHAVLRIAESLPGVESCQN
YLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPY
SKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVA
NRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIII
ISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 16686 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagccgcctggtgaggataaagattcagaatcggcagctgatggacct
gcagcctccgaggaatcaggcgccactgagccagaccttcccaacccacatgtgggggag
gtctcagtgcccagttctgggggtcccagggttcaggagcctctccaggactgcagtggg
ggtccgccgcggcgctgtgctctctgtaactgcggggagcccagtctacacgggcaacgg
gagctacggcgctttgagttgccatttgactggccccggtgtccagtggtgtcccctggg
gggaacccagggcccagtgaggcagcgctgcccagtgaggacctatcacagattggtttc
cctgagggtctgacacctgcccacctaggagaacctggagggtcctgctgggctcaccat
tggtgtgctgcatggtcggcaggcgtatgggggcaggagggcccagaattatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccaggctcggtgcc
tccatcccttgccgctcgcccggatgtccacggctttaccacttcccctgtgcgactgcc
agcggttccttcttatccatgaaaacactgcagctgctatgcccggagcacagtgagggg
gccgcacatctggaggaggctcgttgtgcagtatgtgaggggcccggggaattgtgtgac
ctgttcttctgtaccagctgtgggcatcactatcatggggcctgcctggacactgctctg
actgcccgcaagcgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgctggtctgtgagacttgtgacaaaggataccatacc
ttttgcctaaaaccacctatggaggaactgcctgctcactcttggaagtgtaaggcatgc
cgtgtatgccgggcctgtggggcaagctcagcagagctgaatcccaactctgagtggttt
gagaactactcactctgtcatcgctgtcacaaagcccagggaggacagcctatcagttct
gttgctgagcagcatcctcctgtctgtagcagattcttacccccagagcctggcgatacc
cccactgatgagcccgatgctctgtacgttgcatgccacgggcagccaaagggtgggcac
gtgacctctatgcaacccaaggaaccggggcccctgcaatgtgaagccaaaccactaggg
agagcaggggcccaacttgagccccagttggaggcccccctaaatgaggagatgccactg
ctgcctccacctgaggagtcgcccctgtccccaccacctgaggaatcacccacatccccg
ccgcctgaggcatcgcgtctgtccccaccacctgaggaatcacccctctctccgccacct
gaggagtctcctctgtctcccccacctgagtcgtcacctttttctccactggaggagtca
cccttctctccaccacaggagtcacccccttctcccccacttgagacacccctgtcccca
ccgcctgaaacatcacccctgtccccaccacttgaagagtctcccctgtccccgcctcct
gaggaattgcccacttcccctccacctgaagcatctcgcttgtctccaccacctgaggaa
tcgcctatgtcccctccgcctgaagagtcacccatgtctccaccacctgaagcatctcgt
ctcttcccaccatttgaagaatcacccctgtcccctccaccagaggagtctcccctctcc
ccaccacctgaggcatcgcgcttgtccccaccacctgaggactcacccatgtccccaccg
cccgaagactcacctatgtcccccccgcctgaggtatctcgcctgttgcccttgcctgag
ttgtcacgcctctccccaccgcctgaggaatctcccctgtccccaccacctgaagagtct
cccacgtcccctccacctgaggcttcacgcctatccccaccacctgaagactcacccacg
tctccgcctcctgaagactcacctgcttccccgccacctgaggacttgctcatgtccctg
ccgctggaggagtcacccctgtcaccactgtctgaggaacctcaactctgcccccgaccc
gaggagctgcgcctgtctcctgggtctgaggggcgacatctgtcccctgcatctgagggg
ccatgtctgtcccctcggcctgaggagccacgtctgtcccctcggcctgaggagccatgt
ctgtctccccggcctgaggagccacgtctctccccccggcctgaggagccgtgcctgtcc
cctgcacctgaggagctgcatctgtccccccaacctgaggaaccacccctgtccccccag
cgtgaggagctgcatccgtccccgcagcctgaggagccacccctgtcacctcggcctgag
gagctgcgtctgtccccccatcctgaggagctgcgtctgtccccccatcctgaggagctg
cgtctgtccccccatcctgaggagctgcgtctgtccccccatcctgaggagctccgtctg
tccccccggcctgaggaaacacacctgtccccccagcctgaggaaccgtgcctgtcccct
cgacctgaagagcaccctgagcagccaggcctatgccctgcacctgaggaattgcccttg
ttcctcccacctggggagccacccttgtcccccttgcttggagagccggccctgtctgag
cctggggaaccacctctgtcccctctgcctgaggagctgccgttgtccccatctggggag
ccatccttgtcacctcagctgatgccaccagatcctcttcctcctccgctctcacctatt
atcacagctgtggccccgccagccctgtctcctttgggggagttagagtacccctttggt
gccaaaggggacagtgaccctgagtcgccattggctgctcccatcctagagacacccatc
agccctccaccagaagctaactgcactgaccctgagcctgtaccccctatgatccttccc
ccatctccaggctccccaatgggactggcctctcccgtcctgatggagccccttccccct
cagtgttctccactcctccaggattccctgcctccccaaaactccctgccttcccagtgt
tctcctgctctgccactgtcccttccttccccattgagtcccatggagaaggcagtagag
gtctcagaggaggctgagccacacgagatggagactgagaaagtcccagaacctgagtgc
ccagccttagagcccagccctactagtcctctctcctcccccatggggaacctttcctgc
cctgcacccagccctgccccagctctggatgacttttctggcctgggggaagacatagcc
cctctggatgggactgacactcctggttcacagccagaggctgggcagacccctggcagt
ttggctagtgaacttaagggttcccctgtgctcctggaccccgaggagctggcccctgtg
actcctatggaggtctacggcccagaatgcaagcaggcagggcagggctcaccctgtgaa
gagcaagaggagccacgtgcaccagtggcccctaccccacccactctcatcaaatccgac
atcgttaatgagatctccaatctgagccagggtgatgccagtgccagttttcctggctca
gagcccctgctgggctctcctgaccccgaggggggtggctccttgtccatggagctgggg
gtatctacagatgtcagtccagcccgagatgagggctcccttcggctctgtaccgactcg
ctgccggagactgatgactcgctcttgtgtgatgctgggacagctatcggtggaggcaaa
gctgagggggacaaggggaggcggcgcagctccccagctcgttcccgcatcaaacagggt
cgcagcagtagtttcccgggaagacgccggccacgtggaggagcccatggaggacgtggg
agaggacgggcccggctaaaatcaactacttcttctgttgagactctggtagttgctgat
atcgatagctctcccagcaaggaggaagaagacgatgatgacgacaccatgcaaaatact
gtggttctcttctccaacacagacaagtttgtcctaatgcaggacatgtgtgtggtatgt
ggcagctttggccggggggcagagggccacctccttgcctgttcccagtgctctcagtgc
tatcatccttactgtgtcaacagcaagatcaccaaggtgatgctgctaaagggctggcgt
tgtgtggagtgcatcgtgtgtgaggtgtgtggccaggcctcagacccctcacgcctgctg
ctctgtgatgactgtgacattagctaccacacgtactgcctggaccccccactgctcacc
gtgcccaagggcggctggaagtgcaagtggtgtgtgtcttgtatgcaatgtggggccgcc
tcccctggcttccactgtgaatggcagaatagttatacacattgcgggccctgtgccagc
ctggtgacctgccctatctgtcatgccccatacgtggaggaggacctgctaatccagtgc
cgccactgtgaacggtggatgcatgctggctgcgagagccttttcacagaggatgatgtg
gagcaggcggctgatgagggctttgactgtgtctcctgccagccgtatgtggtcaagccc
gctgcgcctgttgcacctccagagttggtgcctatgaaggtgaaagagccagagccccag
tactttcgcttcgagggtgtgtggctgacagaaactggcatggccgtgctgcgtaacctg
accatgtcacccctgcacaagcggcgccagcggcgaggacggcttggcctcccaggcgag
gcagggttagagggttccgagccctcagatgcccttggccctgatgacaagaaggatggg
gacctggacactgatgagctgctcaagggtgaaggtgctgtagaacacatggaatgtgaa
attaaactggagggccccatcagccctgatggggagcctggcaaagaggagactgaagaa
agcaaaaaacgcaaacgcaaaccctatcggcctggcatcggtggtttcatggtgcgacaa
cggaaatcccacacacgtgtgaaaaaggggcctgctgcacaggcggaggtgttgagtggg
gatgggcagcccgacgaggtgatgcctgccgacctgcctgcagagggctccgtggaccag
agcttagctgatggggacgagaagaagaagcagcagcggcgagggcgcaagaagagcaaa
ctggaggacatgttccctgcttacctgcaggaagccttctttgggaaggagctgctggac
ctgagccggaaggccctttttgcagttggggtgggccggccaagctttgcactaggaacc
ccaaaagccaagggggatggaggctcagataagaaggagctccccacttcacagaaagga
gatgatggtccagatgttgcagatgaagaatctcgtggccccgagggcaagcctgacaca
ccaggacctgaggatgggggcgtaaaggcatccccagtgcctagtgaccccgagaagcca
ggcaccccaggtgaagggatgcttagctctgacttagacaggattcccacagaagaactg
cccaagatggaatccaaggatgtgcaacagctcttcaaggatgttctgggttccgaacga
gagcagcatctgggctgtggaacccctggcctagatggcagccgtacaccgttgcagagg
ccctttcttcaaggtggactctctttgggcaatctcccctccagcagcccaatggactcc
tacccgggcctctgccagtccccattcctggattctagggagcgcgggggcttctttagc
ccagaacccggtgagccagacagcccctggacaggctcagggggcaccacgccctccacc
cctaccacccctaccacggagggtgagggcgacgggctctcctataaccagcggagcctt
cagcgctgggagaaggacgaggagttgggccagctctccaccatctcacctgtgctctat
gccaatatgaactttcccaatctcaagcaagattacccagactggtctagccgttgcaaa
caaatcatgaagctctggagaaaagttccagctgctgacaaagccccctacctgcaaaag
gccaaagataaccgagcggctcaccgcatcaacaaggtgcagaagcaggctgagagtcag
atcaacaagcagaccaaggtgggcgacatggcccgcaagactgaccgaccggccctgcat
ctccgcattcctccccagccaggggccctgggcagcccaccccctgctgccgcccccacc
attttcattggcagccccacaacccccgccggcttgtctacctctgcggacgggttcctg
aagccgccggcgggcacggtgcccggccccgactcgcctggtgagctcttcctcaagctc
ccaccccaggtgcccgcccaagtgccttcgcaggacccctttggactggcccccacctac
gctctggatccccgcttccccacggcaccacccacctatcctccctatcctagtccgact
ggggcccctgcacagccctcaacgctgggcgcttcatctcgtcctgggactggccagcca
ggggaattccacactaccccacctggcaccccccgacaccagccctccacacctgatccc
ttcctcaaaccccgctgcccctcactggacaacctagctgtgcctgagagcccaggggta
gggggaggcaaggcttccgagcccctactgtcacccccgccttttggggaaactcggaag
gctctagaggtgaagaaggaagaacttggggcatcctctcctagctatgggcccccaaac
ctgggctttgtagactcaccctcctcaggcccccacctgggtggcctggagttaaaggca
cctgatgtcttcaaagcccccctgacccctcgggcatctcaggtagagcctcagagcccg
ggcttgggcttaaggccccaggagccagcccctgcccaggctttggccccttctcccccc
agccattcagacatctttcgccctggcccctaccctgacccttatgctcagcccccattg
acccctcggccccaacccccaccccctgagagctgctgtgccctgccccctcgctcactg
ccctctgaccctttctcccgagtgcctgccagtccccagtcccagtccagctcccagtcc
ccgttgacaccccgtcctctctctgctgaggctttctgcccatcccccgttaccccacgc
ttccagtcccctgacccttattctcgccccccatcacgccctcagtcccgtgacccattt
gccccattgcataaaccaccccgaccccagccccctgaagttgccttcaaggctgggcct
ctagcccacaccccgctgggggctgggggcttcccagcagccctgccctcagggccagca
ggtgagctccatgccaaggttccaggtgggcagccccccaattttgcccggtcccctggg
acaggtgcatttgtgggcaccccctcgtccatgcgttttactttccctcaggcagtagga
gaaccttccttaaagccccctgtccctcagcctggcctccctccaccccatgggatcaac
agccattttgggcccggccctaccttgggcaagcctcaaagcacaaacttcacagtagcc
acagggaacttccacccatcgggcagccccctgggacccagcactgggtccacaggagag
ggctatgggctgtccccgctacgcccaccatcagtcctgccaccatctgcacccgatgga
tccctcccctacctgtcccatggagcctcacagcgggcaggcatcacctctccagtcgat
aagcgagaagacccaggggctggaatgggcagctctttggcggcaccagagcttccaggt
acccaggacccaggcatgtccagcctcagccagacagagctggagaagcagcggcagcgc
cagcgactacgggagctactgattcggcagcagatacagcgcaacactctgcggcaggag
aaggaaacagctgcagcagctgcaggagcagtggggactccgggtagctggggtgctgaa
cctagcagtcctgcctttgagcagctgagtcgaggccagacccccttcactgggacccag
gacaagaacagccttgtggggctgcccccaggcaagctgggtggccccatcttggggcca
ggggctttccccagtgatgaccgactgtcccggccacctccaccagccaccccttcttct
atggatgtgaacagccggcaactggtgggaggctcccaagctttctatcagcgagcaccc
tatcctgggtccctgcccttacagcagcagcagcagcaacaactgtggcagcagcagcag
caacagcaacaggcaacggcagcaacctccatgcgactagccatgtctgctcgctttcca
tcagctcctgggcctgaacttggccgccaagccctaggttcccccttggcgggaattccc
acccgcctgcctggccctggtgagccactgcctggtccagctggtcctgcccagttcatt
gagttgcggcacaatgtacagaaaggactagggcctgggggcgctccgtttcctggtcag
ggcccccctcagagaccccgtttttaccctgtaaatgaggactcccaccgactgcctcct
gaaggacttcgaggcctagcagtatcaggccttccgccacagaaaccctcagccccgccg
gcccctgaactgaacaacagcctccatccaacaccccacaccaaggttcccaccctgccc
cctggcttggagctggtcagccggcccccctcgagctctgagcttggccgcccccctcct
ttggccctggaagctgggaagttatcctgtgaggatcctgagctggatgatgactttgat
gcccacaaggccctagaggatgacgaggagcttgctcacttgggcctgggtgtggatgtg
gccaagggagatgatgagctgggcaccctggaaaacctggagaccaacgacccccacctg
gatgacttgctgaatggggatgagtttgacctactggcctatactgatcctgagttggac
actggggacaagaaagatattttcaatgagcacttgaggctggtggagtcagccaatgaa
aaggctgagcgggaggccctgctgcggggggtggagccaggacccttgggcccagaggag
cgccctcctccggctgctgatgcctctgagacccgtctggcatccgtgctccctgaggtg
aagcccaaggtggaggagggtgggcgccacccttccccatgccagttcaccattaccacc
cccaaagtagagccagcgcctgccaccccttccttaggcctggggctgaagccaggacaa
agtgtgatgggcagccgggacacccgaatgggcacaggacccttttctagcagtgggcac
acaactgagaaaggcccctttggcgccacaggaggaccaccatctcacctgttgaccccc
agcccactaagtggcccaggagggtcctccttgctggaaaagtttgagctagagagtggg
accctgaccttgcctggtggacatgcagcatctggggatgagctggacaagatggagagc
tcacttgtagctagtgagttacccctgcttatcgaggacctgttggagcatgagaagaag
gagctgcagaagaagcagcagctttcagcacagctgcagcctgcccagcagcagcagcag
cagcagcagcagcagcagcagcattccctactggccacaccaggccctacccaggccatg
tctttgccacacgagggctcttctcctagtttggctgcaccccaacagcagcttgccctg
ggacttggaggttcccgacagccgggcttggcccaaccgctgatgcctacccagccacca
gctcatgcactccagcagcgcctggccccatccatgaccatggtgtccaaccaagggcat
atgctaagtgggcagcatgggggacaggcaggcttggtgccccagcagagcccacagcca
gtgctgacacagaagcccatgagtaccatgccaccttccatgtgcatgaaaccccagcag
ctggcaatgcaacagcagctggctaacagcttttttccggatacagacctggacaagttt
gctgcagaagatatcattgatcccattgcaaaggccaagatggtggctttgaaaggcatc
aagaaggtgatggctcagggaagcattggagtggcacctggtatgaataggcagcaagtg
tccctgctagcccagaggctctcaggggggcccggcagtgatctgcagaaccacgtggca
gctgggagtggccaggagcggagtgccggtgacccctcccagcctcgtcccaatccaccc
acttttgcccagggagtgatcaatgaggctgaccagcggcagtatgaggagtggctgttc
catacccaacagctcttacagatgcagctgaaggtgctagaggagcagattggtgtgcac
cgcaagtcgcggaaggctctgtgtgccaagcagcgtactgccaaaaaggcaggccgtgag
ttcccagaggcagatgctgagaagcttaagctggttacggagcagcagagcaagatccag
aagcagctggatcaggtccggaagcagcagaaggagcacactaatctcatggcagaatac
cggaataagcagcagcagcagcagcagcaacaacagcagcagcaacactcagccgtgctg
gcccttagcccttcccagagtccccggctactcacaaagctccctggtcagctgctccct
ggccatgggctgcagccaccccaggggccacctggtgggcaagctggaggtcttcgcctg
ccccctgggggcatggcactacctggacagcctggtggccccttcctcaacacgaccctg
gctcaacagcaacaacagcaacattctggtggggctggggccctggctggcccctcaggg
ggctttttccctggcaaccttgctcttcgaggcctaggacctgattcaaggcttttacag
gaaagacagctgcagctacagcagcaacgcatgcaattggcccagaaactgcaacagcag
cagcagcagcagcagcagcagcagcagcacctcctaggacaagtggcaatccagcagcaa
cagcagcagggcccaggggtacaagcaaacccagctctgggccccaagccccaggggctt
ctgcctcccagcagccatcagggcctcttggtccagcagctgtccccccaaccaccccag
gggccccagggcatgctgggccctgcccaggtggcagtgttgcagcagcagcaacagcag
cagcaacagcagcaccaccctggagttttgggtccccagggcccgcacagacaggtgctt
ctgaaccagtctcgggtgctgagttccccccagctggcacagcagggtcagggccttaca
ggacaccggctggtcacagcccagcagcagcagcaacagcaccaacagcagggatctgtg
gcagggctttcccatcttcagcagggtctcatgccacacagtgggcagcccaaactgagc
gctcagcccatgggctccttacagcaacaacagcttcagcaacagcagctacagcagcag
cagcaacagctacagcagcagcagcaacagctacagcagcagcagcaacagctacaacag
cagcagcagcagcagcagcagcagcagcagcagcaacttcaacagcaacaactacaacaa
cagcagtttcaacagcagcagcagcagcagatgggcctcttgaaccagagccgaacttta
ctttctccgcagcagcagcagcagcaacagcagcagcagcagcagcaggtgacgcttggt
cctggcatgccagccaagcctctgcaacgcttttctagccccggagccctgggcccaacc
ctccttctcacgggcaaggaacaaagcattgtagagacagctcttcctccagaggccact
gaggggccctccacacatcagggagggccgttagcagtagcgactgttcctgagtccgtg
gccactgaaccaggggaggtaaagccctcactctctggggacgcgccactcctgcttgtc
caaccccaggcccagcctcagcccaactctgtgcagctgcagccacctctgaggctccca
ggacaacagcagcagcaagttaacttgctccacacagcaggtgcaggaagccatgggcag
ccaaccagcggatcatcttctgaggcctcacctctgccccacctgctggcccaatcctct
gtttctttaggggagcagcctgggcccatgacccagaaccttccgggctctcaacagccc
cttggattagagcggcccatgcaaaataatgcagggtcacagcctgccaaaccaggatct
gccccgcagtctgggcagggcctgcctgggactggactcatgcctacagtgggtcagctt
cgagcacagctccaaggagtcctcgccaaaaacccacagctgcggcacctgagtcctcag
cagcagcagcagctacaggcactgctcatgcagcggcagctgcaacagagtcaggcagta
cgccagaccccaccctaccaggaccctgggacccagccctctccccttcagggcctccta
ggccgccagccccaccttgggggcttccctggatcccagacaggccccctccaggagcta
ggagcagggcttcgacctcagggcgcacctcggctccccaccccacaaggagccttatcc
acaggaccagtccttggccctgtccatcccacacctacaccatccagcccccaagagcca
aagagaccttcctcacaattaccttctcccagctcccagctcccctctgaagcccagctc
acccccatccagccagggaccccaaaaccccaggggccacccttggaactgcctcctggg
aaggtctcacctgcttctgcccagcttgcggatgccttcttcggcaagggggtaggacct
tgggaccccccagacaaccttgcagaagcccacaagccagagcagagcagcctggtacct
ggccatctggagcaggtgaatgggcaggtggcacccgaaccaccccatctcagcatcaag
caggaacctcgggaagagccatgcgccttgggaacgcaggcagtgaagagggaggccaat
ggggagccaataggggcaccaggtaccagcaaccacctcctgctggcaggcccccgctca
gaggctgggcatctgctcttgcagaagcttctacgggcaaagaatgtgcaactcagcact
gggcaggggcctgaggggctgcgagctgagatcaacgggcacattgacagcaagctggct
gggctggagcagaaactacagggtactaccagcaacaaggaggatacagcagccaggaag
cctttgacaccgaagcccaagcgggtacagaaggcaagcgacaggttggtgagctcccga
aagaagctgcggaaggaggacggggtcagggccagcgaggccttgctgaaacagctgaaa
caggagctgtccctgctgcccctaacagagcctaccatcaccgccaatttcagcctcttt
gctccttttggcagtggctgcccgatcaatgggcagtgccagctgaggggggcctttgga
agtggggcgctgcccactggccctgactattattcccagctgcttaccaagaataacctg
agtaacccgccgacaccaccctcgtcgctgccccccaccccacccccatcggtgcagcag
aagatggtaaatggtgtcactgcatctgaagagctgggggagcaccccaaggatgctgcc
tctgcccgggacactgaaggcacactgagggatgcttcagaggtgaagagtctagacctg
ctggccgccttgcctacaccccctcacaatcagactgaggatgtcaggatggagagtgat
gaggacagtgattctcctgacagcattgtgccggcttcatctcctgagagcatcctaggg
gaggaggctcctcgtttccctcagctgggctcaggccggtgggagcaggacgaccgggct
ctctcccctgtcatccccatcattcctcgggccagcatcccagtcttcccagataccaaa
ccttatgggtccctggacctggaggcccctgggaagctgcctgccacaacttgggaaaag
ggcaaaggaagcgaggtgtcagtcatgctgacggtctctgctgctgcagccaagaacctg
aatggtgtgatggtggcagttgcagagctgctaagcatgaagatccccaacaactacgag
gtgctgctcccagagagcccagccagggcaggcattgagcctaagaagggggaagctgag
ggccctggcgggaaagacaagggtctgggcggcaagagtccagaagctggccctgattgg
ctgaagcaatttgatgctgtgttgcctggctataccctcaagagccagctagacatcttg
agcctcctgaaacaggagagccctgccccagagccacctacccaacacagctacacctac
aatgtctccaatctggatgtgcgacagctctcagccccgcctcctgaagaaccctcccca
cccccatcccccttggcaccctctcctgctagccctgctactgaacccctagttgaactt
ccggctgaaccctcagctgagccaccagttccctcgcctctgccactggcttcatcccct
gaatcagcccggcccaagccccgagcccggccctctgaagagggtgaagattcccggacc
cctcgcctcaagaagtggaagggggtgcgttggaagcggctgcggctgctgctgacgatc
cagaagggcagtgggcggcaggaggatgaacgggaagtggcagagtttatggaacagctt
ggaacagccctgcgacccgacaaggtgcctcgagacatgcggcgctgctgcttctgtcat
gaggagggtgatggggccactgatgggcccgcccgcctgctgaacctggacctggacctg
tgggtgcatctcaactgtgccctgtggtccacggaagtatatgagacgcagggtggggcg
ctgatgaatgtggaggttgctctgcaccgaggactgctaaccaagtgctccctgtgccag
cgcactggtgccaccagcagctgtaatcgcatgcgttgtcccaacgtctaccattttgcc
tgcgccatccgcgccaagtgcatgttcttcaaggacaagaccatgctctgtccaatgcat
aagatcaaggggccctgtgagcaggagctgagctcttttgctgtcttccggcgggtctac
attgagcgggatgaggtgaagcaaatcgccagcatcatccagcggggagagcggctacac
atgttccgtgttggaggccttgtgttccatgccattggacagctgctcccccaccagatg
gctgatttccacagtgccactgccctctatcccgtgggctacgaggctacgcgcatctac
tggagtctccgcaccaacaaccgccgctgctgctaccgctgctccattggcgagaacaac
gggcggccagaattcgtcatcaaagtcatcgagcagggcctggaggacctggtcttcact
gatgcctctccccaggctgtgtggaatcgcatcattgagcctgtggctgccatgagaaaa
gaggccgacatgctgcggctcttccccaagtacctgaaaggcgaggagctctttgggctg
acagtgcatgccgtgctgcgcatagctgaatcactgcctggagtggaaagctgtcaaaac
tatttattccgctatggacgccaccccctgatggagctgccactcatgatcaaccccact
ggttgtgcccgatcagagcctaaaatcctcacacactacaaacggccccacaccctgaac
agcaccagcatgtccaaggcatatcagagcaccttcacaggagagaccaacaccccgtac
agcaagcagtttgtgcactccaagtcatctcagtaccggcggctgcgcactgagtggaag
aacaatgtgtacctggctcgctcccgtatccagggcctggggctttatgcagccaaggac
ctagaaaagcacacaatggtcatcgagtacattggcaccatcattcgcaacgaggtggcc
aaccggcgggagaaaatctatgaggagcagaatcgaggcatctacatgttccgaataaac
aatgaacatgtgattgatgctacgttgaccggaggccctgccaggtacattaaccattcc
tgtgcccctaactgtgtggcagaagttgtgacgttcgacaaggaggataaaatcattatc
atctctagccggcgaatccccaaaggagaggagctgacctatgactatcagtttgacttt
gaggacgatcagcacaagatcccctgccactgtggagcctggaattgtcggaaatggatg
aactaa

DBGET integrated database retrieval system