KEGG   Equus caballus (horse): 100059178
Entry
100059178         CDS       T01058                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04934  Cushing syndrome
ecb05200  Pathways in cancer
ecb05204  Chemical carcinogenesis
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100059178 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059178 (ARNT)
   05204 Chemical carcinogenesis
    100059178 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100059178 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100059178 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100059178 (ARNT)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100059178 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 100059178
NCBI-ProteinID: XP_023497000
Ensembl: ENSECAG00000009602
VGNC: 50801
LinkDB
Position
5
AA seq 803 aa
MAATAANPGEETEDWGASKGEEMSSDVPSLGPAIASGNPGPGIQGGGAIVQRAVKRRPGL
DFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTA
YITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHL
ILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLST
SENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFVRN
RCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTS
SPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQL
LRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
SQEPRPTLSSTIQRPQLGPSANLPLEMGTGQLAPRQQQQQTELEVVPGRDGLASYNHSQV
SVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYSNINADQSKGISSSTVPATQQLFSQ
GNTFPPTPRPAENFRNSGLAPSVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPSTRPG
FSAQQVATQATAKTRSSQFGVGNFQTASSFSPMSLPGASTASPGAAAYPSLTNRGSNFAP
ETGQTAGQFQTRTAEGVSVWPQWQGQQPHHRSSSNEQHVQQPSAQPPGQPEVFQEMLSML
GDQSNSYNNEEFPDLTMFPSFSE
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggcggcgactgctgctaaccccggtgaggagacggaggactggggtgcctctaaagga
gaagaaatgtcatcagatgtaccatcactgggtccagccattgcttctggaaaccctggg
cctgggattcaagggggaggagccattgtccagagggctgttaagcggcgaccagggttg
gattttgatgatgatggagaagggaacagtaaatttttgaggtgcgatgacgatcagatg
tctaatgacaaggagaggtttgccaggtcggatgatgagcagagctctgcggataaagag
agactcgccagggaaaatcatagtgaaattgaacggcggcgacggaacaagatgacagcc
tacatcacagaactctcagacatggtacccacctgtagtgccctggctcgaaaaccagac
aagctaaccatcttacgcatggcggtttctcatatgaagtccttgcgaggaactggcaac
acatccactgatggcacctacaaaccatccttcctcactgatcaggagctgaaacatttg
atcttggaggcagcagatggctttctgtttattgtttcatgtgagacaggccgggtggta
tatgtctctgactcagtgacccctgttttgaaccagccacaatctgaatggtttggtagc
acactctatgatcaggtgcacccggatgatgtggacaaacttcgtgagcagctttccact
tcggaaaatgccctgacagggcgtatccttgatctgaagactggaacagtgaaaaaggaa
ggtcagcagtcttccatgaggatgtgtatgggctcaaggagatcgtttatttgccgcatg
aggtgtggcaatagctctgtggacccagtctccatgaacagactgagctttgtgaggaac
agatgcaggaatggacttggctctgtgaaggatggggaacctcacttcgtagtggtccac
tgcacaggctacatcaaagcatggcccccagcaggtgtctccctcccagatgatgaccca
gaggctggccaggggagcaagttttgcctagtggccattggcagactgcaggtaactagt
tctcccaactgtacagatatgagtaatgtttgtcaaccaacagagttcatctctcgacac
aacattgagggaatcttcacttttgtagatcaccgctgtgtggctactgttggctaccaa
ccacaggaactcttaggaaagaatattgtagaattctgtcaccctgaagaccagcagctt
ctaagagacagcttccaacaggtggtgaagttaaaaggccaggtgctgtctgtcatgttc
cggttccggtctaagaaccgagaatggctctggatgagaaccagctcctttactttccag
aacccttactcagatgaaattgagtacatcatctgtaccaacaccaatgtgaagaactcc
agccaggaaccacggcctacactgtccagcacaatccagaggccacagctaggtccctca
gctaatttacccctggagatgggcacagggcagctggcacccaggcagcagcaacagcaa
acggagttggaggtggtaccaggacgagatggactggccagctacaatcattcccaggtt
tctgttcagcctgtgacaaccacagggccagaacacagcaaacccctggagaagtcagat
ggtctatttgcccaggatagagacccaagattttcagaaatctactccaacatcaatgca
gatcagagtaaaggcatctcctccagcactgtccctgccacccaacagctattctcccag
ggcaacacattccctcctacccccaggccggcagagaatttcagaaatagtggtctggcc
ccttctgtaaccatcgtccagccatcagcttctgcagggcagatgttggcccagatttcc
cgtcactccaaccccacccagggagcaaccccaacttggacccctagcacccgcccaggc
ttctctgcccagcaggtggctacccaggctacagccaagactcgctcttcccaatttggt
gtgggcaactttcagactgcatcctccttcagccccatgtccctccctggtgcgtccact
gcctcccctggtgctgctgcctaccctagtctcaccaatcggggatccaactttgcacct
gagactggacagactgcaggacagttccagacacggacagcagagggtgtgagtgtctgg
ccccagtggcagggccagcagcctcatcatcgttcaagttctaatgagcaacatgttcaa
cagccatcagcacaaccacctggccagcctgaggtcttccaggagatgctgtccatgctg
ggagaccagagcaacagctacaacaatgaagaatttcctgatctaactatgtttccctcc
ttttcagaatag

KEGG   Equus caballus (horse): 100067423
Entry
100067423         CDS       T01058                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X1
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100067423 (ARNT2)
   05202 Transcriptional misregulation in cancer
    100067423 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100067423 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100067423 (ARNT2)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100067423 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 100067423
NCBI-ProteinID: XP_023505094
LinkDB
Position
1
AA seq 712 aa
MATPAAVNPPEMASDIPGSVALPVAPMAASGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHSEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPPGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQGQVAWTGSRPPFPGQSSKTQSSPFGIGTSHT
YPADPSSYSPLSSPATSSPSGNAYSGLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHH
GQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcaacgccggcagccgtcaaccctccggagatggcttcagacatccccggatcagtg
gcattgcccgtcgcccccatggcggccagtggccaggtgaggatggctggggccatgcct
gcccgtggaggaaagcggcgttccggaatggactttgatgatgaagatggtgagggtccc
agcaaattttcgagagagaatcacagtgagatcgaacggcgccggcggaacaagatgaca
cagtacatcacggagctctccgatatggtccccacgtgcagtgcgctggcccgaaagccg
gacaagctcaccatcctccgcatggccgtgtcacacatgaagtccatgaggggcacaggg
aacaagtccacggacggcgcctacaagccttccttcctaacggagcaggaactgaagcac
ctcatccttgaagcggccgatggatttctgttcgtcgtggcggccgagacggggcgagtg
atttatgtgtctgactctgtcacccccgttctgaaccagccacagtcagagtggtttggg
agcaccctctacgaacaggtgcatcccgatgacgtggagaagctgagagagcagctgtgc
acctcggaaaattcgatgacaggccggatcttggacctgaagacggggacggtcaagaag
gaagggcagcagtcgtccatgaggatgtgcatgggctcccggaggtccttcatctgcagg
atgaggtgtggaaatgctcctttggatcaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtcaaagagggagaagcccagtacgctgtggtc
cactgcacgggatacatcaaagcttggcctcccgcaggaatgaccatccctgaagaagac
gctgatgtgggacagggcagtaaatactgcctggtggcaatcgggaggctccaggtgacc
agctctcccgtgtgcatggacatgagcgggatgtcagtgcccacggaattcttatcccgg
cataactctgatgggatcatcacatttgtggacccaagatgcatcagtgtgattggctac
caaccccaggatcttctaggaaaagacattttggagttctgccactcggaggatcagagc
catctacgcgagagctttcagcaggtggtgaagctcaaaggccaagtgctgtcggtcatg
tatcgattccgcaccaagaaccgggagtggatgctgatccgcaccagcagcttcaccttc
cagaacccctactctgacgagatcgagtacatcatctgcaccaacaccaacgtcaagcag
cttcagcaacagcaggcagaattggaagtgcaccagagagatgggttgtcatcatacgac
ttatcgcaggttcctgtccccaacctaccagccggagtccacgaggccgggaagtccgtg
gaaaaggcagatgcaatcttttcccaggagagggatccccggtttgctgagatgttcgcg
ggaatcagtgcgtcggagaagaagatgatgagctcagcctcggcagcaggaacccagcag
atctactcccaaggaagccccttccccccgggtcactcggggaaggccttcagctcttcc
gtggtccacgtgcctggagtgaatgacatccagtcctcctcttcaaccggccagaacatg
tcccagatctctcgacagctaaaccagggtcaggtggcatggacggggagtcggccaccc
tttcccggacagtccagcaagactcagtcgtctccctttgggattggaacgagccacacc
tacccggcagacccctcctcctacagtcctctctccagcccagctacctcctcgcccagc
gggaacgcctactccggtctggccaacaggactccagggttcgctgagagtggacagagt
agcgggcagttccaggggcggccgtcggaagtctggtcgcagtggcagagccagcaccac
gggcagcagagcggcgagcagcactcgcaccagcagcctggtcagaccgaagtgttccag
gacatgctgcccatgccaggagaccccacccagggcaccgggaactacaacatcgaagac
tttgccgacctgggcatgttcccgcccttctccgagtag

DBGET integrated database retrieval system