KEGG   Equus caballus (horse): 100059348
Entry
100059348         CDS       T01058                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ecb  Equus caballus (horse)
Pathway
ecb04022  cGMP-PKG signaling pathway
ecb04141  Protein processing in endoplasmic reticulum
ecb04151  PI3K-Akt signaling pathway
ecb04211  Longevity regulating pathway
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04668  TNF signaling pathway
ecb04728  Dopaminergic synapse
ecb04911  Insulin secretion
ecb04915  Estrogen signaling pathway
ecb04918  Thyroid hormone synthesis
ecb04925  Aldosterone synthesis and secretion
ecb04926  Relaxin signaling pathway
ecb04927  Cortisol synthesis and secretion
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb05020  Prion disease
ecb05030  Cocaine addiction
ecb05031  Amphetamine addiction
ecb05034  Alcoholism
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100059348 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100059348 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100059348 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100059348 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100059348 (ATF6B)
   04915 Estrogen signaling pathway
    100059348 (ATF6B)
   04926 Relaxin signaling pathway
    100059348 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100059348 (ATF6B)
   04918 Thyroid hormone synthesis
    100059348 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100059348 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100059348 (ATF6B)
   04927 Cortisol synthesis and secretion
    100059348 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100059348 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100059348 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100059348 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100059348 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100059348 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100059348 (ATF6B)
   05031 Amphetamine addiction
    100059348 (ATF6B)
   05034 Alcoholism
    100059348 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100059348 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100059348 (ATF6B)
   05161 Hepatitis B
    100059348 (ATF6B)
   05163 Human cytomegalovirus infection
    100059348 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100059348 (ATF6B)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100059348 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 100059348
NCBI-ProteinID: XP_001493203
Ensembl: ENSECAG00000021507
VGNC: 15613
UniProt: F6XUS7
LinkDB
Position
20
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDEVAEEQTQLFRCPEQDVPFGS
SSLDVGMDVSPPEPPWDSVPIFPDLQVKSEPSSPCSSSSFTSESSRLSTEPSSQGPGIGE
VLVVKTESLAPPLCLLGDDPTSPFETIQINVGPTSDDPSDVQTKIEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESLSPQGYLLRDVPGPPLGAVQISMGPSPDGSSGKALPTR
KPPLQPKPVVITTVPMPPRAVPASTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEGLLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPVSPQMNGEEPRPRRHLLEFSAQEPVHGVEALQGSTQSHEEPQPSPASRPSFRNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQEKQKS
QLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSSTPGNATGGPLPASAAGQAHQATHRPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacccgttttttcaccgacaac
ttgctgagcccggaggactggggtctgcggaatagcaccttgtacactggtctggatgaa
gtggccgaggaacagacgcagctcttccgttgcccggagcaggatgtcccgtttggcagc
agctccctggacgtgggaatggatgtcagccccccggaacccccctgggactccgtgcct
atcttcccagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccttc
acctctgaatcatcgcgtctttctacggagccctccagccagggtcctggtataggggag
gtgctcgttgtgaagacagagtccttggcacctccactctgcctcctaggagatgaccca
acgtccccatttgaaaccatccagatcaatgtgggccccacctctgatgatccctcagat
gtccagaccaagatagagcctgtctctccgtcttcttccatcaactctgaggcttccctg
ctctcagcagagtcccccaaccaggctttcataggagaggaggtactggaagtgaagaca
gagtctctgtcccctcaagggtatctcctgcgggatgtcccaggccccccacttggagct
gtccagatcagcatgggcccgtcccccgatggctcctcaggcaaagccctgcccacgcgg
aagccaccactgcagcccaaacccgtggtgataaccactgtcccaatgccacccagagct
gtgcctgccagcaccactgtccttttgcagccccttgtccagccacccccagtgtcccca
gttgtcctcatccaaggtgctattcgagtccagcctgaggggccagccccccctgcacca
aggcctgagaggaagagcattgttccagctcctatgcctgggaactcctgtccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggaatcagcctgc
cagtccaggaggaagaagaaagagtatctgcaggggctggaggctcgactgcaggctgtg
ctggccgacaaccaacagctccgccgggagaatgctgccctccggcggcggctggagggc
ctgctggctgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaacttcgggcctgtcagcatcagtgagcctcct
tcggctcccgtgtctcctcagatgaacggagaggagcctcgacctcggagacacttgctg
gagttctcagcacaagagccggttcatggagttgaggccctccagggctccactcagagc
catgaggagccccagcccagccccgcaagcaggccaagcttcaggaacctgacagccttc
cctgggggtgccaaggagctgctgctgagagacctggaccagctcttcctctcctctgat
tgccggcacttcaaccgaaccgagtccctgaggcttgctgacgagctgagcggctgggtc
cagcgccaccagagaggccggcggaagatcccccagagggcccaggagaaacagaagtct
cagctacggaagaagtcgcctccagttaaggcagtccccacccaaccccccgggccccca
gaaagggattctgtgggccagctgcagctgtatcgccacccagaccgttcacagccagag
ttcctggatgcaattgaccgacgggaagacacattttatgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtg
atgcctgccatggcgcccaacgagaccctgtcaggccggggggccccaggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagccgtcctcaaccccaggcaatgccacaggtggc
cccttgccagcttctgcagctggccaggcccaccaggccacccatcggcccctctacctc
aatcatccctga

DBGET integrated database retrieval system