KEGG   Equus caballus (horse): 100059815
Entry
100059815         CDS       T01058                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04144  Endocytosis
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04540  Gap junction
ecb04630  JAK-STAT signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05218  Melanoma
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100059815 (PDGFRA)
   04014 Ras signaling pathway
    100059815 (PDGFRA)
   04015 Rap1 signaling pathway
    100059815 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100059815 (PDGFRA)
   04020 Calcium signaling pathway
    100059815 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100059815 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100059815 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100059815 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100059815 (PDGFRA)
   04540 Gap junction
    100059815 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100059815 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059815 (PDGFRA)
   05206 MicroRNAs in cancer
    100059815 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100059815 (PDGFRA)
   05231 Choline metabolism in cancer
    100059815 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100059815 (PDGFRA)
   05218 Melanoma
    100059815 (PDGFRA)
   05215 Prostate cancer
    100059815 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100059815 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100059815 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100059815 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ecb04090]
    100059815 (PDGFRA)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100059815 (PDGFRA)
Protein kinases [BR:ecb01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100059815 (PDGFRA)
CD molecules [BR:ecb04090]
 Proteins
  100059815 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 100059815
NCBI-ProteinID: XP_001492327
Ensembl: ENSECAG00000018176
VGNC: 21261
UniProt: F7A2X2
LinkDB
Position
3
AA seq 1089 aa
MGTCHRALLVLGCLLTGPSLSFCQLSLPSILPNEDEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQTEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVLASYDSRQGFNG
TFSVGPYICEATVKGKKFRTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLSVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPNFSRLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLTPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttgccatcgggcactcctggtcttaggctgtctcctcacagggcccagccta
agcttctgccagctttcattaccctccatcctcccaaatgaagatgaaaaggttgtgcag
ctgaactcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
atgtctgaagaagagaaccctaacgtggaaatcagaaatgaggaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcagcagcccacacgggattgtacacttgc
tattacaaccacacgcagacagaagaaagcgagatcgaaggcaggcgcatttacatctat
gtgccagaccctgatgtggccttcgtacctctaggaatgacagactatttagtcatcgtg
gaggatgatgattctgccatcatcccttgtcgcacgactgatcctgagactccagtgacc
ttactcagcagtgacggggtggtactcgcctcctacgacagcagacagggctttaacgga
accttcagcgtcgggccctacatctgcgaggccaccgtcaaagggaagaagtttcggacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagagatggaagct
cttaagactgtgtataagtcgggggaaacgattgtggtcacctgtgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtacaccctgagcgtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggccaccagggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaaggcttcattgaaatcaaacccaac
ttcagccggctggaagccgttgacctgcatgaggtcaaacattttgtggtggatgtgcag
gcctacccgcctcctaggatatcctggctgaaggacaacctgactctgatcgaaaatctc
actgagatcaccactgacatagaaaagatccaggaaataaggtaccgaagcaaattaaag
ctgatccgtgcaaaggaagaagacagtggtcattatactattgtagttcaaaatgaagat
gatgtaaagagctatacctttgaactcttaactcaagttccctcatctattctggacttg
gtcgacgaccaccatggctctaccgggggtcagactgtgagatgcacagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcgtggacgattttggctaacaacatctcaaacatcatcacggaggtccacccccgagac
aggagtactgtggagggccgagtgacgtttgccaaagtggaggagaccattgccgttcgg
tgtctggctaagaatctccttggggctgagaaccgagagctgaagctggtggctcccact
ctacgttctgaactcacagtggcagctgcggtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaagcagaaaccgaggtacgaaattcgttggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggcctcgtgcttggtcgtatcctggga
tctggtgcgtttgggaaagtggtcgaaggaactgcttatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggcccaatttacatcatcacagagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgacccctgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgctggagaggaaagaggtttctaaatattcggacatccagaggtcg
ctgtatgatcgcccagcctcatataagaagaaagctatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggcctaactttgctggatttgttgagcttcacttat
caagttgcccgaggaatggagtttttggcttcaaagaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattccaactacgtgtccaaaggcagcacctttctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagg
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagattcacctggacttcctgaagagcgatcatcccgccgtggcacgcatg
cgcgtggactctgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggttgagtgcggacagtggctacatcatc
cctctgccggacatcgaccctgttccggaggaggaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctaccttcatt
aagagagaggatgagaccattgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system