KEGG   Equus caballus (horse): 100060005
Entry
100060005         CDS       T01058                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100060005 (GNA12)
   04072 Phospholipase D signaling pathway
    100060005 (GNA12)
   04071 Sphingolipid signaling pathway
    100060005 (GNA12)
   04022 cGMP-PKG signaling pathway
    100060005 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100060005 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100060005 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100060005 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    100060005 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060005 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100060005 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100060005 (GNA12)
   04031 GTP-binding proteins [BR:ecb04031]
    100060005 (GNA12)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100060005 (GNA12)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100060005 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100060005
NCBI-ProteinID: XP_023510949
VGNC: 51137
LinkDB
Position
13
AA seq 382 aa
MSGVVRTLSRCLLPAEAGGARERRAGGGGARDAEREARRRSRDIDAGLARERRAVRRLVK
ILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPW
QHSENEKHGMFLMAFENRAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESV
KYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWF
QCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMD
LLVEKVKTVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENI
RFVFHAVKDTILQENLKDIMLQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtccggcgtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcggcggcggggcccgcgacgcggagcgcgaggcgcggcggcgc
agccgggacatcgacgcggggctggcccgcgagcggcgcgccgtgcggcgcctcgtcaag
atcctgctgctgggcgcgggcgagagcggcaagtccaccttcctcaagcagatgcgcatc
atccacggccgcgagttcgaccagaaggcgctgctcgagttccgcgacaccatcttcgac
aacatcctcaagggttcaagagttcttgtggatgcgcgagacaagcttggcattccttgg
cagcactcggaaaacgaaaagcatgggatgttcctcatggccttcgagaaccgagcgggg
ctgcccgtggagcccgccaccttccagctgtacgtgcccgctctgagcgcgctctggagg
gactctggcatcagggaggccttcagccggaggagcgagttccagctgggtgaatcggtg
aagtacttcctggataacctggaccggatcggccagctgaattactttcccagtaagcaa
gacatcctactggcgaggaaagccaccaagggcattgtggaacatgacttcgttattaaa
aaaatcccttttaaaatggtggatgtgggaggccagcggtcccagcgccagaagtggttc
cagtgctttgacgggatcacgtcgatcctgttcatggtgtcttccagtgagtacgaccag
gtcctcatggaggacaggcgcaccaaccggctggtggagtcgatgaacatctttgagaca
atagtcaacaacaagctcttcttcaacgtctccataatcctgttcctcaacaagatggac
ctcctggtggagaaggtgaagaccgtcagcatcaagaagcacttcccggatttcaagggc
gacccccacaggctggaggacgttcagcgctacctggtccagtgcttcgaccggaagagg
cggaaccgcagtaagccgctcttccaccacttcaccaccgccatagacactgagaacatc
cgcttcgtgtttcacgctgtgaaggacaccatcctgcaggagaatctgaaagatatcatg
ttgcagtga

KEGG   Equus caballus (horse): 100062972
Entry
100062972         CDS       T01058                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
ecb  Equus caballus (horse)
Pathway
ecb04022  cGMP-PKG signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04611  Platelet activation
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05163  Human cytomegalovirus infection
ecb05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100062972 (GNA13)
   04072 Phospholipase D signaling pathway
    100062972 (GNA13)
   04071 Sphingolipid signaling pathway
    100062972 (GNA13)
   04022 cGMP-PKG signaling pathway
    100062972 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100062972 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100062972 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100062972 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100062972 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    100062972 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100062972 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100062972 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100062972 (GNA13)
   04031 GTP-binding proteins [BR:ecb04031]
    100062972 (GNA13)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100062972 (GNA13)
  Exosomal proteins of colorectal cancer cells
   100062972 (GNA13)
GTP-binding proteins [BR:ecb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100062972 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100062972
NCBI-ProteinID: XP_023507934
Ensembl: ENSECAG00000017724
VGNC: 18414
LinkDB
Position
11
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDDSNQLNGD
KMMAFDTRSPMAAQGMVETQVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcgtgctg
acgagcggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcccgg
gagaagacctacgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggta
gatgcccgagagaagcttcacattccttggggagatgactcaaaccaactcaatggagac
aagatgatggcattcgatacccggtcccctatggcggcccagggaatggtggaaactcaa
gtttttttacagtatcttcctgctatacgagcattatgggcagacagtggcatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaactcggagagccagattacattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcattcatgagtacgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtaggtggtcaaagatcagaaagaaaacgttggtttgaatgtttcgacagtgtg
acatccatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagaatctctgaacatttttgaaacaattgtcaataaccgggtt
ttcagcaatgtctccataattcttttcttaaacaagacagatttgcttgaggagaaagtg
caaattgtgagcatcaaagactatttcttagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccgtaacaaacgccgggaccagcagcagaag
cccttgtaccaccacttcaccactgcgatcaacacggagaacatccgcctcgtcttccgt
gacgtgaaggataccattcttcacgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system