KEGG   Equus caballus (horse): 100060371
Entry
100060371         CDS       T01058                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05216  Thyroid cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100060371 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100060371 (RXRG)
   03320 PPAR signaling pathway
    100060371 (RXRG)
   04919 Thyroid hormone signaling pathway
    100060371 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100060371 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060371 (RXRG)
   05202 Transcriptional misregulation in cancer
    100060371 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    100060371 (RXRG)
   05216 Thyroid cancer
    100060371 (RXRG)
   05222 Small cell lung cancer
    100060371 (RXRG)
   05223 Non-small cell lung cancer
    100060371 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100060371 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ecb03310]
    100060371 (RXRG)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100060371 (RXRG)
Nuclear receptors [BR:ecb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100060371 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 100060371
NCBI-ProteinID: XP_023496573
Ensembl: ENSECAG00000024377
VGNC: 22641
LinkDB
Position
5
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHSSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGTLAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIP
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggcaattattctcacttcatgaagtttcccacaggctttggcggctcccccggc
cactctggctccacgtccatgagcccatcggcagccttgtccacagggaaaccaatggac
agccactccagctacacggacaccccagtgagtgccccacggactctgagtgcagtgggg
accccccttaatgccctgggttctccatatcgagtcatcacttctgccatgggcccaccc
tcaggaacgctggcagcccctccgggaatcaatttggttgctccacccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcctttgccagggcttcctggg
attggaaacatgaactacccgtccaccagccctggatctctggttaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactatggtgtgtacagctgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgtgagcgtgcc
gagagtgaggcggaatgtgccagtagtggccatgaagatatgccggtggagaggattcta
gaagctgaacttgctgttgaaccaaagacggaatcctatggtgacatgaacatggagaac
tcaacgaatgaccccgtcaccaacatatgccatgctgctgataagcagcttttcactctc
gttgaatgggccaagcgcattccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgattgcctccttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacacgtccacaggagcagtgcccacagt
gctggggttggctccatctttgacagagttctgactgagctggtctccaaaatgaaagac
atgcagatggataagtctgagctggggtgtctgcgagccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctctgaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccggaacaaccaggcaggtttgccaagctgctg
ctgcgcctcccagccctgcgctccatcggcttgaagtgcctggagcatctcttcttcttc
aagctcatcggggacacgcccatcgacaccttcctcatggagatgttggagaccccgctg
cagatcccctga

KEGG   Equus caballus (horse): 100061303
Entry
100061303         CDS       T01058                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X3
  KO
K08525  retinoid X receptor beta
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05216  Thyroid cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100061303 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100061303 (RXRB)
   03320 PPAR signaling pathway
    100061303 (RXRB)
   04919 Thyroid hormone signaling pathway
    100061303 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100061303 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061303 (RXRB)
   05202 Transcriptional misregulation in cancer
    100061303 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100061303 (RXRB)
   05216 Thyroid cancer
    100061303 (RXRB)
   05222 Small cell lung cancer
    100061303 (RXRB)
   05223 Non-small cell lung cancer
    100061303 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100061303 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ecb03310]
    100061303 (RXRB)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100061303 (RXRB)
Nuclear receptors [BR:ecb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100061303 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100061303
NCBI-ProteinID: XP_014589828
Ensembl: ENSECAG00000023041
VGNC: 22640
LinkDB
Position
20
AA seq 440 aa
MPQGSVGRWGCEKKCIVGSRPGGGGDGPGWIPRQQRRRREPENNKPRSRSRGRLDGTGWA
TAGGINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHY
GVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQE
ERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILL
ATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKG
LSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccgcagggcagtgtgggccggtgggggtgcgaaaagaaatgcattgtggggtcgcgt
cccggtggcggcggcgacggccctggctggatcccgcggcagcagcggcggcggcgggag
ccggagaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgggcg
acagcgggcgggattaactcaacagtgtcgctccctgggggtgggtctggcccccctgaa
gatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggc
cctggggctggcaaacggctatgtgcaatctgcggggaccgaagctcaggcaaacactat
ggggtttacagctgtgagggctgcaaaggcttcttcaagcgcaccatccggaaggacctg
acctactcgtgccgggacaacaaagactgtacggtggacaagcgccagcggaaccgctgt
cagtactgccgctatcagaagtgcctggccacgggcatgaagagggaggcggtacaggag
gagcgtcagcgggggaaggacaaggatggggatggggagggggctggaggagcccctgaa
gagatgcccgtggacaggatcctggaggcagagctggctgtggagcagaagagtgaccag
ggcgttgagggtcctgggggaaccgggggtagcggcagcagcccaaatgaccctgtgact
aacatctgtcaggcagctgacaaacagctattcacgcttgttgagtgggcaaagaggatc
ccacacttttcctccttgcctctggatgaccaggtcatattgctacgggcaggctggaat
gaactcctcattgcctccttttcccaccgatccattgatgtccgagatggcatcctcctc
gccacaggtcttcacgtgcaccgcaactcagcccattctgcaggcgtgggagccatcttt
gatcggtccctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatg
gacaagacagagcttggctgcctgagggcaatcattctgttcaatccagatgccaagggc
ctctccaaccccagtgaggtagaggtcctgcgagagaaagtgtatgcatcactggagacc
tactgcaaacagaagtaccctgagcagcagggacggtttgccaaactgctgctacgtctt
cctgccctcaggtccatcggccttaagtgtctagaacatctgtttttcttcaagctcatt
ggtgacacccccatcgacacctttctcatggagatgctcgaggctccccatcagctggcc
tga

KEGG   Equus caballus (horse): 100069096
Entry
100069096         CDS       T01058                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb03320  PPAR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04932  Non-alcoholic fatty liver disease
ecb04976  Bile secretion
ecb05160  Hepatitis C
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05216  Thyroid cancer
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100069096 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100069096 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100069096 (RXRA)
   03320 PPAR signaling pathway
    100069096 (RXRA)
   04919 Thyroid hormone signaling pathway
    100069096 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100069096 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    100069096 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100069096 (RXRA)
   05202 Transcriptional misregulation in cancer
    100069096 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    100069096 (RXRA)
   05216 Thyroid cancer
    100069096 (RXRA)
   05222 Small cell lung cancer
    100069096 (RXRA)
   05223 Non-small cell lung cancer
    100069096 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100069096 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100069096 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100069096 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ecb03310]
    100069096 (RXRA)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100069096 (RXRA)
Nuclear receptors [BR:ecb03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100069096 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 100069096
NCBI-ProteinID: XP_005605975
Ensembl: ENSECAG00000019365
VGNC: 22639
LinkDB
Position
25
AA seq 439 aa
MAAPSLHPSLGPGMGSSLGSPGQLHSPISSLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTEAYVEANVGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctagggcctggcatgggctcctcgctcggctcc
cccggacagctgcactcgcccatcagctccttgagctcgcccatcaacggcatgggcccg
cccttctccgtcatcagctcccccatgggcccccactccatgtccgtgcccaccacacct
accctgggcttcggcactggcagcccccagctcaactcgcccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctgaacggcgtcctcaaggtcccggcccacccc
tcagggaacatggcatccttcaccaagcacatctgtgccatctgcggggaccgctcctca
ggcaagcactacggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgtctgatcgacaagcggcag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaa
gccgtgcaggaggagcggcagcggggcaaggacaggaatgagaatgaggtggagtccacg
agcagcgcaaacgaggacatgccggtggagaagatcctagaggctgagctggctgtggag
cccaagactgaggcatacgtggaggcgaacgtggggctgaaccccagctcgcccaacgac
cctgtcaccaacatctgccaggcagcggacaagcagctcttcaccctggtggagtgggcc
aagcggatcccgcacttctccgagctgcccctggacgaccaggtcatcctgctgcgggca
ggctggaacgagctgctcatcgcctccttctcccaccggtccatagctgtgaaggacggg
atcctgctcgccaccgggctgcacgtgcaccggaacagcgcccacagcgcgggggtgggc
gccatcttcgacagggtgctgacggagcttgtgtccaagatgcgcgacatgcagatggac
aagacggagctgggctgcctgcgtgccatcgtcctcttcaacccggactccaaggggctc
tcgaacccggccgaggtggaggccctgcgggagaaggtctacgcgtccctggaggcctac
tgcaaacacaagtaccccgagcagccgggaaggttcgccaagctgctgctgcgcctgcct
gccctgcgctccatcggcctcaagtgcctggaacatctcttcttcttcaagctcattggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccgcaccaaatgacttag

DBGET integrated database retrieval system