KEGG   Equus caballus (horse): 100060381
Entry
100060381         CDS       T01058                                 

Gene name
FH
Definition
(RefSeq) fumarate hydratase, mitochondrial
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00020  Citrate cycle (TCA cycle)
ecb00620  Pyruvate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04934  Cushing syndrome
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Module
ecb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100060381 (FH)
   00620 Pyruvate metabolism
    100060381 (FH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060381 (FH)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100060381 (FH)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100060381 (FH)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     100060381 (FH)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 100060381
NCBI-ProteinID: XP_023488568
Ensembl: ENSECAG00000020726
VGNC: 18033
LinkDB
Position
30
AA seq 508 aa
MYRALRLVARPRRLFRAPGAASAPDSCGAAALPCRPSSAARMASQNSFRIEYDTFGELKV
PNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQDYGLDPKIANAIMK
AADEVAEGKLNEHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVN
KSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPL
TLGQEFSGYVQQVKYATTRIQAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTG
LPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENE
PGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARL
LGDAAVSFTENCVVGIQANTERISKLMSESLMLVTALNPHIGYDKAAKIAKTAHKNGSTL
KATAVELGYLTAEQFDEWVKPKDMLGPQ
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtaccgcgcgctccggctcgtcgcgcgcccacggcgcctcttccgggctccgggcgca
gcctcggctccggactcctgtggcgcggcggccctcccctgccggccctcgagcgccgcg
cgaatggcatctcaaaattcctttcggatcgaatatgatacctttggtgaactgaaggtc
ccgaatgataagtattatggtgcccagaccgtgagatccaccatgaactttaagattgga
ggtgtgacagagcgcatgcccattccagttattaaagcttttggcatcctgaagcgagcg
gctgctgaagtaaaccaggattatggtcttgatccaaagattgctaatgcaataatgaag
gcagcagatgaggtagctgaaggtaaattaaatgagcattttcctctcgtggtgtggcag
actggatcaggaacgcagacaaatatgaatgtaaatgaagtcattagcaatagagcaatt
gaaatgctaggaggtgaacttggcagcaagaagcccgtgcaccccaatgatcatgttaat
aaaagccagagctcaaatgacactttccccacagcaatgcacattgctgctgcaatagaa
gttcatgaagtgctgctcccaggactgcagaagctacacgatgccctcgatgccaagtcc
aaagagtttgcccagatcatcaaaattgggcgcactcacacacaggatgctgttccgctg
acgcttgggcaggaatttagcggttatgttcaacaagtgaagtatgcaacgacgagaata
caagctgccatgccgagaatctatgagctcgcagctggaggcactgctgtcggtactggt
ttgaatactagaattggctttgcagaaaaggttgctgccaaagtggctgcactcacaggc
ttgcccttcgtcacagctccgaataaatttgaagctctggctgctcatgatgctttggtt
gaactcagtggagccatgaacactaccgcttgcagtctgatgaagatagcaaatgatatt
cgatttctgggttctggtcctcgctccggtctgggagaactgatcttgcctgaaaatgaa
ccaggaagcagtattatgccaggcaaggtgaaccctacccagtgtgaagccatgaccatg
gttgcagcccaagtcatggggaaccacgtcgctgttaccgttggaggcagcaatggacat
tttgagttgaatgttttcaagccaatgatgattaaaaatgtgttacactcagccagactg
ctgggggatgcggcagtttccttcacagaaaactgcgtggtgggaatccaggccaacacg
gagaggatcagcaagctcatgagcgaatccctgatgttggtgacagctcttaatcctcat
atagggtatgacaaggcagcaaagattgctaagacggcacacaagaatgggtcaacctta
aaggcaactgccgtggagcttggctatctcacggcggagcagtttgatgagtgggtaaag
cccaaggacatgctgggtccacagtga

DBGET integrated database retrieval system