KEGG   Equus caballus (horse): 100060423Help
Entry
100060423         CDS       T01058                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04915  Estrogen signaling pathway
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05223  Non-small cell lung cancer
ecb05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100060423 (TGFA)
   04010 MAPK signaling pathway
    100060423 (TGFA)
   04012 ErbB signaling pathway
    100060423 (TGFA)
   04151 PI3K-Akt signaling pathway
    100060423 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100060423 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060423 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100060423 (TGFA)
   05212 Pancreatic cancer
    100060423 (TGFA)
   05225 Hepatocellular carcinoma
    100060423 (TGFA)
   05214 Glioma
    100060423 (TGFA)
   05211 Renal cell carcinoma
    100060423 (TGFA)
   05215 Prostate cancer
    100060423 (TGFA)
   05223 Non-small cell lung cancer
    100060423 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100060423 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF EGF_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 100060423
NCBI-ProteinID: XP_005599966
VGNC: 51415
LinkDB All DBs
Position
15
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGVLSAVCQALENTTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSVVALAVLIIACVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtgttttgtcggctgtgtgc
caggccctggagaacaccacgtccgccctgagtgcagacccacctgtggccgcagctgtg
gtgtcccattttaatgactgcccggattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctggatatgttggtgca
cgctgtgagcacgcagacctcctggccgtggtggccgccagtcagaagaagcaggccatc
accgccttggtggtggtctctgtcgtggccctggctgtcctcatcatcgcatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactccgaaacagtggtc
tga

DBGET integrated database retrieval system