KEGG   Equus caballus (horse): 100060428Help
Entry
100060428         CDS       T01058                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    100060428 (F13A1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100060428 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100060428
NCBI-ProteinID: XP_001492734
Ensembl: ENSECAG00000008295
VGNC: 17755
LinkDB All DBs
Position
20
AA seq 732 aa AA seqDB search
MSETSGTTFGGRRAIPPNNSNAAENDPPTVELQGPVPRGVNLQDYLNVTNVHLFKEKWDT
NKLDHHTDKYDSNKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PVVSELQSGKWGAKVVMRERTSVRLSIQSSPECIVGKFRMYVAVWTPYGVIRTSRNPETD
TYILFNPWCEEDAVYLDDAKEREEYVLNDIGVIFYGDVSDIKSRSWSYGQFEDGILDACL
YVMDRAKMDLSGRGNPIKVSRVGSAMVNARDDEGVLVGSWDNVYAYGVPPSAWTGSVDIL
LEYHSSENPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQTDIFLEEDGN
VNSKLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQALKH
GHICFQFDAPFVFAEVNSDVVYITAKKDGTHVVETVDATHIGQLIVTKQVGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEDVTKLKSDVDMDFEVENAVLGKDFKLTITF
RNQSPTRYTISAYLSGNITFYTGVSHVEFKNETFKVTLEPLSVKKEEVLIRAGEYMGQLL
EQASLHFFVTARVNETKVVLAKQKSTVLTIPKVIIKVRGAKVVGSDMVVTVEFTNPLKQT
LRNVWIYLEGPGVIKPKRKLFREIPPNSTVQWEEASRPWVSGRRKLIASMTSDSLRHVYG
ELDLQIQRRPAE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagacctccgggaccacctttggcggcaggagagccattcccccgaacaactcc
aatgctgcagagaacgaccccccaactgtggagctgcagggcccggtgccccggggcgtc
aacctgcaagactaccttaatgtcacgaatgttcacctgttcaaggagaaatgggatacc
aacaaattggatcaccacactgacaagtatgacagcaacaagttgattgtacgcagagga
cagtctttctacatccagatcgacttcaatcgtccatacgaccccagaagggatctcttc
agagtggaatatgttattggtcgctaccctcaggagaacaagggaacctacatcccggtt
cctgttgtctcggagctgcaaagtggcaagtggggggccaaagttgtcatgagggagcgc
acgtctgtccggctgtccatccagtcctctccggagtgcattgtggggaaattccgcatg
tacgttgctgtctggaccccgtatggagtaatccgtaccagccgaaacccagaaacggac
acatacattcttttcaatccttggtgtgaagaggatgctgtgtacctggatgatgctaaa
gaaagagaagagtatgtcctgaatgacattggggttattttttatggagacgtcagtgac
atcaagagtagaagctggagctatggtcagtttgaggatggcatcctcgatgcttgcttg
tatgtgatggacagagcaaaaatggacctttctggtagaggaaatcccatcaaagtcagc
cgtgttgggtctgcaatggttaatgccagagatgacgaaggtgtccttgttggatcctgg
gacaatgtctatgcctatggcgttcccccgtcagcctggaccggaagcgttgacattctg
ttggaataccatagttctgaaaatcctgtccggtatggtcagtgctgggtttttgctggt
gtctttaacacatttttgcgctgccttgggataccagcaagggttgttaccaattatttc
tcagcccatgataataatgccaatttgcaaacagacatcttcctggaagaagatgggaac
gtgaactccaaactcaccaaggattcgatttggaactaccactgctggaatgaagcctgg
atgacaaggcctgatcttcccgttggattcggaggttggcaggtcgtggacagcaccccc
caggaaaacagtgatgggatgtatcggtgtggcccggcctccgttcaagcccttaagcat
ggtcacatttgcttccagtttgatgcaccctttgtttttgcagaggtcaacagtgatgtt
gtttacattacagctaagaaagatggcactcatgtggttgaaactgttgatgccacccac
attgggcaattaattgtgaccaagcaagttggaggagatggcataaaggatatcactgat
acttacaaattccaagaaggtcaagaagaagagagactggccctagaaactgccctgatg
tatggagctaaaaagcccctcaacacagaagatgtcaccaaattgaagtctgatgttgac
atggactttgaagtggagaatgccgtgctgggaaaagacttcaagctcaccatcaccttc
cggaaccaaagccccactcgctacaccatctcagcctatctctcaggcaacatcaccttc
tacactggggtctcccatgtggaattcaagaacgagacattcaaggtgacgctggagccc
ttgtccgtcaagaaagaggaggtgctgatcagagcgggcgagtatatgggccagctgctg
gaacaagcgtctctgcacttctttgtcacggctcgcgtcaatgagaccaaagttgttctg
gccaagcagaagtccactgtgctgacaatccccaaggtcatcatcaaggtccgtggggcc
aaagtggtcggttctgacatggttgtgacagttgagttcaccaatcctttaaaacagact
ctgcgaaatgtttggatatacctggaaggtcctggagtgataaaaccaaagaggaagttg
ttccgtgaaatcccgcccaactccactgtgcaatgggaagaagcgtctcggccttgggtg
tctggccgtcggaagctgatagccagcatgaccagtgactccctgagacacgtgtacggc
gagctggatttgcagatccaaagaagacctgctgagtaa

DBGET integrated database retrieval system