KEGG   Equus caballus (horse): 100060647Help
Entry
100060647         CDS       T01058                                 

Gene name
CAT
Definition
(RefSeq) catalase isoform X1
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00380  Tryptophan metabolism
ecb00630  Glyoxylate and dicarboxylate metabolism
ecb01100  Metabolic pathways
ecb01200  Carbon metabolism
ecb04068  FoxO signaling pathway
ecb04146  Peroxisome
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100060647 (CAT)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100060647 (CAT)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100060647 (CAT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100060647 (CAT)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100060647 (CAT)
   04213 Longevity regulating pathway - multiple species
    100060647 (CAT)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100060647 (CAT)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     100060647 (CAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 100060647
NCBI-ProteinID: XP_001914753
Ensembl: ENSECAG00000019408
VGNC: 16079
LinkDB All DBs
Position
12
AA seq 527 aa AA seqDB search
MGDSRDPATDQMKHWKEQRAAQQPDVLTTGAGIPIGDKLNIMTAGPRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFDQIGKRTPIAVRFSTVAGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAMLFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNAKGEVVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFDQAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPNNMPPGIEPSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPFRTRVANYQRDGPMCMFDNQGGAPNYYPNSFSAPEQQPSALE
RKSQCSPDVQRFNSANEDNVTQVRAFYLHVLDEEHRKRLCQNIAGHLKDAQLFIQKKAVK
NFSDVHPDYGARVQALLDKYNAEKPKNAIHTFVQSGSHLSATEKANL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggggacagccgggacccagccaccgaccagatgaagcactggaaggagcagcgggcc
gcgcagcagcctgatgttctgaccaccggggctggtatcccaataggagacaaactcaat
attatgacggcagggccccgagggcccctccttgttcaggatgtggttttcactgatgag
atggctcactttgaccgggagagaattcctgagagagtcgtgcatgctaaaggagcaggg
gcttttggctactttgaggtcacgcatgacatcaccagatactccaaggcaaaggtgttt
gaccagattggcaagaggactcccattgcggttcgattctctaccgttgctggagaatca
ggctcagctgacacagttcgtgaccctcgtgggtttgcggtgaaattttacactgaagat
ggtaattgggatcttgttggaaataatacccccattttcttcatcagggatgccatgttg
tttccgtcctttatccacagccaaaagagaaaccctcaaacgcacctgaaggatccggat
atggtctgggatttctggagtctgcgtcctgagtctctgcatcaggtttctttcctgttc
agtgatcgaggcattccggatggacataggcacatgaatggatatggatcacatactttc
aagctggttaatgcgaagggagaggtagtttattgcaaattccattataagactgaccag
ggcatcaaaaacctttctgttgaagacgcagcaagactctcccaggaagaccctgactac
ggcctccgggacctttttaacgccattgccacaggcaactacccatcctggaccttgtac
atccaggtcatgacatttgatcaggcagaaacttttccatttaacccatttgatcttacc
aaggtttggcctcacaaggactaccctcttatcccagttggtaagctggtcttaaaccgg
aacccagttaattattttgctgaggttgaacagttggcctttgacccaaacaacatgcca
cctggcattgagcccagcccggacaaaatgcttcagggccgcctttttgcctatcctgac
acccaccgccaccgcctgggacccaactatcttcagatacccgtgaactgtcccttccgc
actcgagtggccaactaccaacgcgacggccccatgtgcatgttcgacaaccagggtggc
gctccgaattactaccccaatagcttcagtgctccggagcaacagccttctgccctggaa
cgtaaaagccagtgctctccagacgtgcagcgtttcaacagtgccaacgaggacaacgtc
actcaggtgcgcgccttctacttgcacgtgctggatgaagagcacaggaagcgcctgtgc
cagaacatcgccggccatctgaaggacgcgcagcttttcatccagaagaaagcggtcaag
aacttcagtgatgtccatcctgactacggggcccgcgtccaggctcttttggacaaatac
aatgctgagaaacctaagaacgcgattcacacctttgtgcagtctgggtcccacttgtct
gcgacggaaaaagctaatctgtga

DBGET integrated database retrieval system