KEGG   Equus caballus (horse): 100060870
Entry
100060870         CDS       T01058                                 

Gene name
XIAP
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP isoform X1
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04064  NF-kappa B signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04510  Focal adhesion
ecb04621  NOD-like receptor signaling pathway
ecb05145  Toxoplasmosis
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100060870 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100060870 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100060870 (XIAP)
   04215 Apoptosis - multiple species
    100060870 (XIAP)
   04217 Necroptosis
    100060870 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100060870 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100060870 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060870 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100060870 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100060870 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100060870 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100060870 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100060870 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100060870 (XIAP)
   03029 Mitochondrial biogenesis [BR:ecb03029]
    100060870 (XIAP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100060870 (XIAP)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I32: IAP family
   100060870 (XIAP)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100060870 (XIAP)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100060870 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 100060870
NCBI-ProteinID: XP_005614538
Ensembl: ENSECAG00000020071
UniProt: F7BTS0
LinkDB
Position
X
AA seq 494 aa
MTFNSFEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENNAAQPTNPGVQNGQYKVENY
LGNRNHFVLGRPSETHAEYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PGELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVVSSDRNFSNSTNLPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALGEGDKVQC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQEYISNIHLTCSLEESLVRTAEKTT
ERIDDTIFRNPMVQEAIRMGFSFRDIKKIMEEKIHTSGSNYRSLEILVADLVNAQKDNTQ
DESSQTSLQQEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPM
CNTVITFKQKIFMS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcgataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcagcctcaacactagcacgagctggttttctctatactggtgaaggggacact
gtgcagtgctttagttgtcacgcagcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
aatgctgcgcaacctacaaatcctggtgtccagaatggtcagtacaaagttgaaaactat
ctgggaaacagaaatcattttgttttaggcaggccatctgagactcatgcagaatacctt
ttgagaactggacaggttgtagacatatcagataccatatacccgaggaaccctgccatg
tgtagtgaagaagctagattaaagtcatttcaaaattggccagactatgcccacttaacc
ccaggagagttagctagtgctggactctactacacaggtattgatgatcaagtgcagtgc
ttttgttgtggtggaaaactgaaaaactgggaaccttgtgatcgtgcgtggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatgttaatattcgaagtgaa
tctgatgtcgtgagttctgataggaatttctcaaattcaacaaatcttccaagaaatcca
gccatggcagattatgaagcacggatcattacttttgggacgtggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtgcagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagatccttgggaacaacat
gctaagtggtatccagggtgtaaatatctgttagaagagaaggggcaggagtatataagc
aatattcatttaacctgttcactggaggagtctctggtaagaactgctgaaaaaacaact
gaaagaattgatgataccatcttccgcaatcccatggtacaagaagctatacgaatggga
ttcagtttcagggacattaagaaaataatggaggaaaaaattcacacatctgggagcaac
tatagatcactcgaaattttggttgcagatctagtgaatgctcagaaagacaatacacaa
gatgaatcaagtcagacttcattgcagcaagagattagtgctgaagagcagctaaggctc
ctgcaagaggagaagctttgcaaaatctgcatggatagaaatattgctgtagtttttatt
ccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaatgtcccatg
tgcaacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Equus caballus (horse): 100061273
Entry
100061273         CDS       T01058                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04064  NF-kappa B signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04390  Hippo signaling pathway
ecb04510  Focal adhesion
ecb04621  NOD-like receptor signaling pathway
ecb04668  TNF signaling pathway
ecb05132  Salmonella infection
ecb05145  Toxoplasmosis
ecb05168  Herpes simplex virus 1 infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100061273 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100061273 (BIRC2)
   04064 NF-kappa B signaling pathway
    100061273 (BIRC2)
   04668 TNF signaling pathway
    100061273 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100061273 (BIRC2)
   04215 Apoptosis - multiple species
    100061273 (BIRC2)
   04217 Necroptosis
    100061273 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100061273 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100061273 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061273 (BIRC2)
   05202 Transcriptional misregulation in cancer
    100061273 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100061273 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100061273 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100061273 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100061273 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100061273 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100061273 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100061273 (BIRC2)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I32: IAP family
   100061273 (BIRC2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100061273 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100061273
NCBI-ProteinID: XP_023500479
Ensembl: ENSECAG00000000609
VGNC: 15832
LinkDB
Position
7
AA seq 599 aa
MEDSTILSSWTVGNKQKMKYDFSCELYRMSTYSTFPTGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSVTSLESTSKNTSSPMRNSFTHSL
SPTLEHSGSFSGSYSNLSPNLVNSRAVEDFSPLRTNPYSYAMSTEEARFLTYHMWPLTFL
SPSELARAGFYYIGPGDRVACFACGGTLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRF
SISNLSMQTHAARLRTFMYWPPRVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPRCEFLISMKGQEFVDEIQARYPHLLEQLLSTSDTPGDENADPPIVHFG
PGESSSEDAVMMNTPVIKAALEMGFSRSLVKQTVQSKILTTGENYKTVNDIVSALLNAED
EKREEEKERQTEEMASDDLSLIRRNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQK
TQIPLQARELIDTVLVKGNAAANIFKNCLKEIDSTLYENLFVEKNMKYIPTEDVSGLSLE
EQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPALRKCPICRGIIKGTVRTFLS
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggaagatagcacaatcttgtcaagttggacagtcggcaacaaacaaaaaatgaaatat
gacttttcatgtgaactctacagaatgtctacatattcaactttccccaccggtgttcct
gtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataactggaaacaaggagacaatcctattgaa
aaacataaacagctatatcctagctgtagctttattcagaatctggtttctgttactagt
ctggaatccacctctaagaatacttcttctccaatgaggaacagttttacacattcatta
tctcccactttggaacatagtggctcattcagtggttcttattccaacctttcaccaaac
cttgttaattctagagcagtcgaagacttctcccctttgaggactaacccctacagttat
gcaatgagtactgaagaagctagatttcttacttaccatatgtggccattaaccttttta
tcaccatcagaattggcaagagctggcttttattatataggacccggagatagggtagcc
tgctttgcctgtggtgggactctaagtaactgggaaccaaaggatgatgctatgtcagaa
caccggaggcatttccccaactgtccatttttggaaaattctctggaaacgctgaggttt
agcatttcaaatttgagcatgcagacacatgcggctcgactgagaacatttatgtactgg
ccacctcgtgtaccagttcagcctgagcagcttgcaagtgctggtttctattatgtgggt
cgaaatgatgatgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaatctgga
gatgacccatgggtggaacatgccaagtggtttccaagatgtgagttcttgataagcatg
aaagggcaggagtttgttgatgagattcaagctagatatcctcatcttcttgaacagctg
ttgtcaacttcagacactcctggagatgaaaatgctgatccaccaattgttcattttgga
cctggagaaagttcttctgaagatgcagtcatgatgaatacacctgtgattaaagctgcc
ttggaaatgggcttcagtagaagcctggtaaaacagacagttcagagtaaaatcctaaca
actggagagaattacaaaacagttaatgatatcgtgtcagcacttcttaatgctgaagat
gaaaaaagagaagaggagaaggaaagacaaactgaagaaatggcatcagatgatttatca
ttaattcggaggaatagaatggccctctttcagcagttgacgtgcgtgcttcctatcctg
gataatcttttaaaggccaatgtaattaataagcaagaacatgatattattaaacaaaaa
actcagatacctttacaagcaagagaactcattgataccgttttagttaaaggaaatgct
gctgccaacatcttcaaaaactgtctaaaagaaattgactctactttatatgagaactta
tttgtggaaaagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaa
gaacagttgaggaggctccaggaagaaagaacttgtaaagtgtgtatggacaaagaagtt
tctattgtgttcattccttgtggtcatctggtagtatgccaggaatgtgcccctgctcta
agaaagtgtcctatttgcaggggtataattaagggtactgttcgtacgtttctgtcataa

KEGG   Equus caballus (horse): 100068894
Entry
100068894         CDS       T01058                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ecb  Equus caballus (horse)
Pathway
ecb01524  Platinum drug resistance
ecb04064  NF-kappa B signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04210  Apoptosis
ecb04215  Apoptosis - multiple species
ecb04217  Necroptosis
ecb04390  Hippo signaling pathway
ecb04510  Focal adhesion
ecb04621  NOD-like receptor signaling pathway
ecb04668  TNF signaling pathway
ecb05132  Salmonella infection
ecb05145  Toxoplasmosis
ecb05168  Herpes simplex virus 1 infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100068894 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100068894 (BIRC3)
   04064 NF-kappa B signaling pathway
    100068894 (BIRC3)
   04668 TNF signaling pathway
    100068894 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100068894 (BIRC3)
   04215 Apoptosis - multiple species
    100068894 (BIRC3)
   04217 Necroptosis
    100068894 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100068894 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100068894 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100068894 (BIRC3)
   05202 Transcriptional misregulation in cancer
    100068894 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100068894 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100068894 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100068894 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100068894 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100068894 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100068894 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100068894 (BIRC3)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I32: IAP family
   100068894 (BIRC3)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100068894 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100068894
NCBI-ProteinID: XP_001499925
Ensembl: ENSECAG00000012229
VGNC: 15833
UniProt: F6SJV8
LinkDB
Position
7
AA seq 604 aa
MNIVENSVFLSNLMKSANMFELKYDFSCELYRISTYSTFPPGVPVSERSLARAGFYYTGI
NDRVKCFCCGLMLDNWKQGDNPTEKHKKLYPSCSFVQNLNSVNISGATSQLAFSSSVTNS
THSLLPSLENSGYFSGSYSSFPSNPVNSGPNHDFSALRTSPYHCAMNTEKARLLTFQMWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPNCPFVENQFE
DTSRYTVSNLSMQTHAARFRTFCNWPSSVQVPPEQLASAGFYYMGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFISRVQANYPHLLEQLLSTSDNPEDENAESP
IIHFGPGENHSEDAVMMNTPVVKAALEMGFSRRLIKQTVQSKILTTGENYKTISDLVLEL
LNAEDEMREEEKERATEEKESGDLSLIRKNRMALFRHLTCVLPILDSLLTARVINEQEYD
VIKQKTQTSLQSRELIDTILVKGNFAATIFKNSLQEIEPTLYKHLFVQQDIKYIPTEDVS
DLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaacagcgtattcttatcaaatttgatgaaaagcgccaatatgttt
gaattgaagtatgacttttcttgtgaactgtaccgaatatctacgtattcgactttccct
cctggtgtccctgtctcagaaaggagccttgcccgcgctggtttttattacaccggtata
aatgacagagtcaaatgcttctgttgtggcctgatgctggataactggaaacaaggagac
aatcctactgaaaagcataaaaagttgtatcctagctgtagctttgttcaaaatctaaat
tcagttaacatttcgggagccacctctcaacttgctttttcttcttcagtaacaaattcc
acacattcattacttccaagtttggaaaacagtggctacttcagtggctcctattcaagc
tttccatcaaaccctgtaaactctggaccaaatcacgatttttctgccttgaggacaagt
ccctaccattgtgcaatgaataccgaaaaagccagattactcactttccagatgtggccg
ctgacctttctgtcgccaacagatctggcaaaagctggcttttactacataggacccggg
gacagagtggcctgctttgcctgtggtggaaaattgagcaattgggaaccgaaggatgat
gctatgtccgaacacctgagacatttccccaactgcccgtttgtagaaaaccagtttgaa
gacacttcaagatacaccgtttctaacctgagcatgcagacacatgcagcccgctttaga
acattctgtaactggccctctagtgttcaggttcctcctgagcagctggcaagtgcgggt
ttttattatatgggtcacagtgatgatgtcaaatgcttttgctgtgatggtggattgagg
tgttgggaatctggagatgacccatgggtggaacatgccaagtggtttccaaggtgtgaa
tacttgatacgaattaagggacaagagttcatcagtcgagttcaagccaattaccctcat
ctacttgaacagctcttgtctacttcagacaatccagaagatgaaaacgcagagtcacca
attattcattttggacctggagaaaaccattcagaagacgcagtcatgatgaatacacct
gtggttaaagctgctttggaaatgggcttcagtagaaggctgataaaacagacagttcag
agtaaaatcctaaccactggagagaattacaaaaccatcagtgatcttgtgttagagtta
cttaatgcagaagatgagatgagggaagaggagaaagaaagagcaactgaagaaaaagaa
tcaggcgatctctcattaatccggaagaatagaatggcactttttcgacatttgacgtgt
gtgcttccaatcctggatagtctactaactgccagagtgattaatgaacaggaatatgat
gttattaaacagaagacacaaacatctttacaatcaagagaactgattgatactatttta
gtaaaaggaaattttgctgccaccatattcaaaaactctctacaagaaattgagccaacg
ttatacaagcatttatttgtgcaacaggacataaagtatattcccacagaagatgtttca
gatttaccaatggaagaacaactgaggagactacaagaagaaaggacatgtaaagtgtgt
atggacaaagaggtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgccccttctctaagaaaatgtcctatttgtagagggacaatcaagggtactgttcgt
acatttctttcatga

KEGG   Equus caballus (horse): 100147373
Entry
100147373         CDS       T01058                                 

Gene name
BIRC7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
ecb  Equus caballus (horse)
Pathway
ecb04120  Ubiquitin mediated proteolysis
ecb04215  Apoptosis - multiple species
ecb05145  Toxoplasmosis
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100147373 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100147373 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100147373 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100147373 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100147373 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecb01002]
    100147373 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100147373 (BIRC7)
Peptidases and inhibitors [BR:ecb01002]
 Peptidase inhibitors
  Family I32: IAP family
   100147373 (BIRC7)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100147373 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 DUF2039
Other DBs
NCBI-GeneID: 100147373
NCBI-ProteinID: XP_001915144
Ensembl: ENSECAG00000020286
VGNC: 15835
LinkDB
Position
22
AA seq 285 aa
MGPEDKAKCWCRGLELSHQAAGGSPMQGHHRPHCLCGCILGQDTGRALSWGGRDHVDGQI
LGQLHPLAEEEEEGAGAVAAPSTRPAFPRMGSEELRLASFCHWPLTAVVRPELLAAAGFF
HTGWQDKVRCFFCHGGLQSWERGDDPWTEHAKWFPRCEFLLQTKGRDFVCRVQESCCHQL
SSWDQLEEPEDAAPSVPSTPVHRGPDPPMPRREAQSGAREPGAQNVEEQLQRLREERTCK
VCLDRAVSVVFVPCGHLVCAECAPNLQLCPICRAPIDSCVRTFLS
NT seq 858 nt   +upstreamnt  +downstreamnt
atggggcctgaggacaaggctaagtgctggtgccgcggcctggagctgagccaccaggca
gctggtggcagccccatgcaggggcaccatagaccccactgtctgtgtggctgcatcctg
ggccaggacactggcagagccctgtcctggggaggccgggaccacgtggacgggcagatc
ttgggccagctgcaccccctggcagaggaagaggaggagggagcaggggccgtggccgcc
ccatccacaaggcctgccttccccaggatgggctctgaggagctacggctggcctccttc
tgtcactggccgctgaccgccgtagtacgacccgagctgctagctgccgctggcttcttc
cacaccggctggcaggacaaggtgaggtgcttcttctgccatgggggtctgcagagctgg
gagcgaggggatgacccctggactgagcacgccaagtggttccccagatgtgaattcctg
ctccagacaaaagggagggacttcgtctgcagggtgcaggagtcttgttgccaccagctc
agctcctgggatcaattggaagaaccagaagacgctgccccctcagtgcccagcactcct
gtccaccggggtcctgacccacccatgcccagaagagaggcccagtcaggtgctagggag
ccaggagcccagaatgtggaggagcagctgcagcgcctgcgggaggagcggacctgcaag
gtgtgcctggaccgagccgtgtcagtcgtcttcgtgccctgcggccacctggtctgtgct
gagtgtgcgcccaacctgcagctctgccccatctgcagggcccccatcgacagctgcgtg
cgcaccttcctgtcctag

DBGET integrated database retrieval system