KEGG   Equus caballus (horse): 100060902
Entry
100060902         CDS       T01058                                 

Gene name
ELOC
Definition
(RefSeq) elongin-C
  KO
K03872  elongin-C
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100060902 (ELOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100060902 (ELOC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100060902 (ELOC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100060902 (ELOC)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100060902 (ELOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100060902 (ELOC)
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100060902 (ELOC)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     100060902 (ELOC)
   ECS complex
     100060902 (ELOC)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100060902 (ELOC)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 100060902
NCBI-ProteinID: XP_001493068
Ensembl: ENSECAG00000000064
VGNC: 17536
UniProt: F7D5C0
LinkDB
Position
9
AA seq 112 aa
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaaa
ttgatatcctctgatggccatgaatttattgtaaaaagagaacacgcactaacatcagga
acaatcaaagccatgttgagtggcccaggtcagtttgctgagaacgagactaatgaagtc
aattttagagagatcccttcacatgtgttgtcaaaagtatgcatgtattttacctacaag
gttcgctacactaacagctccacggagattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system