KEGG   Equus caballus (horse): 100061166
Entry
100061166         CDS       T01058                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb04066  HIF-1 signaling pathway
ecb04137  Mitophagy - animal
ecb04140  Autophagy - animal
ecb04659  Th17 cell differentiation
ecb04919  Thyroid hormone signaling pathway
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05211  Renal cell carcinoma
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100061166 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100061166 (HIF1A)
   04137 Mitophagy - animal
    100061166 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100061166 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100061166 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061166 (HIF1A)
   05205 Proteoglycans in cancer
    100061166 (HIF1A)
   05230 Central carbon metabolism in cancer
    100061166 (HIF1A)
   05231 Choline metabolism in cancer
    100061166 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100061166 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100061166 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100061166 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100061166 (HIF1A)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100061166 (HIF1A)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 HIF-1 PAS PAS_9 PAS_4 HLH DDRGK
Other DBs
NCBI-GeneID: 100061166
NCBI-ProteinID: XP_023483625
Ensembl: ENSECAG00000015597
VGNC: 18782
LinkDB
Position
24
AA seq 823 aa
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNGNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKISQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTDT
DDQQLEEVPLYNDVMLPLSNEKIQNINLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSSSPQSASTITVFQ
PTQMQEPALPTVTNTAANDELKTVTKDGMEDIKILIASPSPTHVPKETTSATTSPYSDTR
SRTASPNRAGKGVIEQTEKSHPRSPNVLSVTLSQRTAVPEEELNPKILALQNAQRKRKIE
HDGSLFQAVGIGALLQQPDDRATTTSLSWKRIKGCKSSEQNGMEQKTIILIPSDLACRLL
GQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgcgaacgacaagaaaaagataagttctgagcgtcgaaaagaa
aagtctagagatgcagccagatctcggcggagtaaagagtctgaagttttttatgagctt
gctcatcagttgccacttcctcataatgtgagctcacatcttgataaggcgtctgttatg
aggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggatatt
gaagatgaaatgaaggcacagatgaattgcttttatttgaaagctttggatggttttgtt
atggttctcacagacgatggtgacatgatttacatttctgataatgtgaacaaatacatg
ggattaactcagtttgaactaactggacacagtgtgtttgattttactcatccgtgtgac
catgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaaaagggtaaagag
caaaatacacagcgaagcttttttctcagaatgaagtgtaccctgacaagccgggggaga
actatgaacataaagtctgcaacatggaaggtacttcactgcacaggccacattcatgta
tatgacaccaatggtaaccagtctcagtgtgggtataagaaaccacccatgacatgcttg
gtgctgatttgtgaacccattcctcatccttcaaatattgaaattcctttagatagcaag
acttttctcagtcgtcacagtctggatatgaaattttcttattgtgatgaaagaattacc
gaattgatgggatatgagccagaagaacttttgggccgctcaatttatgaatattaccat
gctttggactcggatcatctgaccaaaactcatcatgatatgttcactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagagggggatatgtctgggttgaaactcaa
gcaactgtcatatataacactaagaactctcaaccacaatgcattgtatgtgtaaattat
gttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
ctcaaaccagttgaatcttcagatatgaaaatttctcagctattcaccaaagttgaatca
gaagatacaagtagcctctttgataaacttaagaaggaacctgatgctttaactttgctt
gccccagctgctggagacacaatcatatctttagattttggcagcaatgacacagacact
gatgaccaacaacttgaggaagttccattgtataatgatgtaatgctcccattatccaat
gaaaaaatacagaatataaatttggcaatgtctccattacctgcctctgaaactccaaag
ccacttcgaagtagtgctgaccctgcactcaatcaggaagttgcattaaaattggaacca
aatccagagtcactggaactttcttttaccatgccccagattcaggatcagccagctagt
ccttctgatggaagcactagacaaagttcaccagagcctaacagtcccagtgaatattgt
tttgatgtggatagtgatatggtcaatgaattcaagttggaattggtagagaaacttttt
gctgaagacacagaagcaaagaatccattttccactcaggacacggacttagacctggag
atgttagctccttacatcccaatggatgatgacttccagttacgttccttcgatcagttg
tcaccattggaaagcagttcttcaagccctcaaagtgcgagcacgattacagtattccag
ccgactcaaatgcaagaacctgctcttcctaccgtcactaacactgctgccaatgatgaa
ttaaaaacagtgacaaaagatggtatggaagacattaaaatattgattgcatctccatct
cctacccacgtccctaaagaaactactagtgccacaacatcaccatatagtgatactcga
agtcgaacagcctcaccaaacagagcaggaaaaggagtcatagaacagacagaaaaatct
catccaagaagccctaatgtgttatctgtcactttgagtcaaagaactgccgttcctgag
gaagaactaaatccaaagatcctggcgttgcagaatgctcagagaaagcgcaaaatagaa
catgacggttcactttttcaagcagtaggaattggcgcattactacagcagccagatgat
cgtgcaacgactacatcactttcttggaaacgcataaaaggatgcaaatctagtgagcag
aatggaatggagcagaagacaattattttaataccctctgatttagcatgtagattgctg
gggcaatcaatggatgagagtggactaccacagctgaccagttacgattgtgaagttaac
gctcccatacaaggcagcagaaacctactgcagggtgaagagttactcagagctttggat
caagttaactga

KEGG   Equus caballus (horse): 100068622
Entry
100068622         CDS       T01058                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1 isoform X2
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb05200  Pathways in cancer
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100068622 (EPAS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100068622 (EPAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100068622 (EPAS1)
   04131 Membrane trafficking [BR:ecb04131]
    100068622 (EPAS1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100068622 (EPAS1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    100068622 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 HLH Corona_I PLD_C
Other DBs
NCBI-GeneID: 100068622
NCBI-ProteinID: XP_005600062
Ensembl: ENSECAG00000014594
VGNC: 17607
LinkDB
Position
15
AA seq 871 aa
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELVGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNGIFDNSGEVAASEKSNFLFTKLKEEPEELAQLAPTAGDAIISLDFGSQN
FEESSAYGKAILPPSQPWAGELRSHGTQSEARSLPAFTVPQAAAPGSTTPSASSSSSCST
PSSPGDYYTSLNDDLKIEAIEKLFAMDTEAKDQCSTHTDFNELDLETLAPYIPMDGEDFQ
LSPICPEERLLPENPQSIPQQCFSTMTNIFQPLAPVDPHRPFLLDKYQQQLESKKIEPEH
RPMSSIFFDGGTKASLPLCCGQASTPLSSMGGRSNTQWPPDPPLHFGPAKWPVGNQHTES
LGASPLGPPVTSPHLSMFKKRSAKGFGPRDPDTMSPAMIALSNKLKLKRQLEYEEQAFQD
MSGADPPGSSASHLMWKRMKSLRGGGNCPLMPDKPLSANVPSDEFTQNPLRGLSQPLRHL
PPPPQPPSAVSPRENAKSGFPPQCYAPQYQDYGLPSAHKLSGMASRLLGPSFEPYLLPEL
TRYDCEVNVPVPGSSTLLQGGDLLRALDQAS
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaagaggagtagctcagagaggaggaaggagaagtcccga
gatgctgcaaggtgccggaggagcaaggagacggaggtcttctacgagctggctcatgag
ctgcccctgccgcacagcgtgagctcccacctggacaaggcctctatcatgcggctggct
atcagcttcctgcgaacacacaagctcctgtcctcagtttgctctgaaaatgagtctgaa
gctgaggctgaccagcagatggacaacttgtacctgaaagccttggagggtttcattgcc
gtggtgacccaagatggcgacatgatctttctgtcagaaaacatcagcaagttcatggga
ctcacacaggtggagctaacaggacatagtatctttgacttcactcatccctgtgaccat
gaggagatccgtgagaacctgagtctcaaaaatggctctggttttgggaagaaaagcaaa
gacatgtccacagaacgggacttcttcatgaggatgaagtgcacggtcaccaacagaggc
cgaactgtcaacctcaagtcagccacctggaaggtcttgcactgcactggccaggtgaaa
gtctacaacaactgcccccctcataatagtctctgtggctacaaggagcccctgctctcc
tgcctcatcatcatgtgtgaacccatccagcacccgtcccacatggacatccccctggat
agcaagaccttcctgagccgccacagcatggacatgaagttcacctactgtgacgacaga
atcacagaactggttggttaccaccctgaggagctgcttggccgctcagcctatgagttc
taccatgcactggactcagagaatatgaccaaaagtcaccagaacctgtgcaccaagggt
caggtggtgagcggccagtatcggatgcttgcaaagcatgggggctacgtgtggctagag
acccaggggactgtcatctacaaccctcgcaacctgcagcctcagtgcatcatgtgtgtg
aactacgtcctgagtgagatcgagaagaacgacgtggtgttctccatggaccagacagaa
tccctcttcaagccccacctgatggccatgaacggcatctttgacaacagtggcgaggtg
gctgcgtctgagaagagtaacttcctgttcacaaagttgaaggaggagcccgaggagctg
gcccagctggcccccactgcgggagatgccatcatttctctggatttcgggagccagaac
tttgaggagtcctcagcctatggcaaggccatcctgcccccaagccagccatgggccgga
gagctgaggagccacggcacccagagcgaggccaggagcctgccggctttcaccgtgccc
caggcggccgccccagggagcaccacacccagtgccagcagcagcagcagctgctccacg
cccagcagccctggagactactacacatctctgaatgatgatctgaagattgaagcaatc
gagaagctctttgccatggatacagaggcgaaggatcaatgcagcacccatacggatttc
aatgagctggacttggagacgctggcaccttacatccccatggatggtgaagacttccag
ctcagtcccatctgcccggaggagaggctcttgccggagaacccccagtccatcccccag
cagtgcttcagtaccatgacgaacatcttccagccactggcccctgtggaccctcacaga
ccctttctcctggacaagtatcagcagcagctggagagcaagaagatagagcccgagcac
cggcccatgtcctccatcttctttgatggcgggaccaaggcatccctgccattgtgttgt
ggccaggccagcacccctctctcctccatggggggcagatccaacacacagtggccccct
gacccgccattacatttcgggcccgcgaagtggcctgttgggaatcagcacaccgagtcc
ttgggggcatcgccactggggccccctgtcacctcgccccatctctccatgttcaagaag
aggtctgcaaagggctttgggcctcgggacccagacacgatgagcccggccatgatagcc
ctctccaacaagctgaagctgaagcgacagctggagtacgaggagcaagccttccaggac
atgagtggggcggatccaccaggcagcagcgcgtcacacttgatgtggaaaaggatgaag
agccttaggggcggcgggaactgccctttgatgcctgacaagccactgagtgcaaatgtc
cccagtgatgagttcacccaaaatccactgaggggcctgagccagcccttgagacatctg
ccaccaccaccacagccgccatctgccgtgagccccagggagaacgccaagagtgggttc
cccccacagtgttatgccccccagtaccaggactacggcctgccctcggctcacaagttg
tcaggcatggcaagtcggctgctcgggccttcgtttgagccttacctgctgcccgaattg
accagatatgactgtgaggtgaacgttcctgtgccaggaagctccacgctcctgcaagga
ggggacctcctcagagccctggaccaggcctcctga

DBGET integrated database retrieval system