KEGG   Equus caballus (horse): 100061217
Entry
100061217         CDS       T01058                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
ecb  Equus caballus (horse)
Pathway
ecb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100061217 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecb03000]
    100061217 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ecb03310]
    100061217 (NR3C1)
Transcription factors [BR:ecb03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100061217 (NR3C1)
Nuclear receptors [BR:ecb03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100061217 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100061217
NCBI-ProteinID: NP_001182120
Ensembl: ENSECAG00000009473
VGNC: 20869
LinkDB
Position
14
AA seq 775 aa
MDCKESLSSPGREEIPSSVLGQERGNVMDFYKTLRGGAPLKLSASSPSLAAASQSDSKQQ
RLLVDFPKGAGSNAPQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQTSLPSGETDF
RLLEESIANLNRSTSVPENPKSSASVAVSAAPTEKEFPKTHSDVSSEQQNLKGQTGTSRG
NVYTTDQRTFDILPDLEFSSGSPSKETNESPWRADLLIDENCLLSPLAGEDDSFLLEGNS
NEDYKPLVLPDAKPKIKDNGDLTLSSPNSVPLPQVKTEKEDFIELCTPGVIKQEKLGPVY
CQASFSGAKIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGS
ENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPPPKLCL
VCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCL
QAGMNLEARKTKKKIKGIQATTGVSPQETSENPANKTIVPATLPQLTPTLVSLLEVIEPE
VLYAGYDSSIPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMF
LMAFALGWRSYRQSSGSMLCFAPDLIINEQRMTLPCMYDQCKHMLYIASELHRLQVSYEE
YLCMKTLLLLSSVPKEGLKSQDLFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLL
DSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggactgcaaggaatcattaagctcccctggcagagaagaaatccccagcagtgtgctt
ggtcaggagagggggaatgtgatggacttctataaaaccctaaggggaggagctcctctg
aagctctcagcgtcttcaccctcactggctgcggcttctcagtcagactccaagcagcag
agacttttggttgattttccaaaaggcgcaggaagcaatgcgccacagccagatctgtcc
aaggccgtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatggga
aatgacttgggattcccacagcagggccaaaccagccttccctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagagttcagcatccgttgctgtttctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtgtcttcagaacagcaaaatctgaagggccagactggcaccagcagaggc
aatgtgtataccacagaccaaagaacctttgacattttgccggatttggagttttcttct
gggtccccaagtaaagagacgaatgagagtccttggagagcagacctcttgatagatgaa
aactgtctgctttctcctttggcaggagaggatgattcattccttttggaaggaaactcg
aatgaagactataagcctctcgttttaccggatgctaaacctaaaattaaggataatgga
gatctgaccttatcaagccccaacagtgtgccactgccccaagtgaaaacagaaaaagaa
gatttcatcgaactctgcacccctggggtaattaagcaggagaaactgggcccagtttac
tgtcaggcaagcttttctggggcaaagataattggtaataaaatgtctgccatttctgtt
catggtgtgagtacctctgggggacagatgtaccactatgacatgaatacagcatccctt
tctcaacagcaggatcagaagcctattttcaatgtcattccaccaattcctgttggttca
gaaaattggaataggtgccagggatctggagatgacaacttgacttccttggggactctg
aacttctctggccgatcggttttttctaatggctattcaagccctggaatgagaccagat
gtaagctctcctccatccagctcctcagcggcaacgggaccacctccgaaactctgcctt
gtgtgctctgatgaagcttcaggatgtcattatggggtcttgacttgtggaagctgtaaa
gtattcttcaaaagagcagtggaaggacagcacaattatctttgtgctggaagaaatgat
tgtatcattgataaaattcgaagaaaaaactgcccggcatgccgctatcgaaaatgtctt
caagctggaatgaacctggaagctcgaaaaacaaagaaaaagataaaaggaattcaggcc
actacaggagtctccccacaagaaacttctgaaaatcctgccaacaaaacaatagttcct
gcaacattaccacaactcacccctactctggtgtcactgttggaggtgattgaacccgaa
gtgctatatgcaggatatgatagctctattccagactccacttggcggatcatgaccaca
ctcaacatgttaggtgggcggcaagtgattgcagcagtgaaatgggcaaaggcgatacca
ggattcaggaacttacacctggatgaccaaatgaccctactgcaatattcctggatgttc
ctcatggcatttgccctggggtggagatcatacagacaatcaagtggaagcatgctgtgt
tttgctcctgatctgattattaatgaacagagaatgactctaccctgcatgtatgaccaa
tgtaaacatatgctgtatatcgcctctgagttacacaggcttcaggtatcttatgaagag
tatctctgcatgaaaaccttactgcttctctcttcagttcctaaggaaggtttgaagagc
caagatctgtttgatgaaatcagaatgacctacatcaaagagctaggaaaagccattgtc
aagagggaaggtaactccagtcagaactggcagcggttttatcaactgacaaaactcttg
gactccatgcatgatgtggttgaaaacctccttaactattgcttccagacatttttggat
aagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcagatacca
aaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system