KEGG   Equus caballus (horse): 100061732
Entry
100061732         CDS       T01058                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04310  Wnt signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04520  Adherens junction
ecb04530  Tight junction
ecb04620  Toll-like receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04670  Leukocyte transendothelial migration
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04932  Non-alcoholic fatty liver disease
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04972  Pancreatic secretion
ecb05014  Amyotrophic lateral sclerosis
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05100  Bacterial invasion of epithelial cells
ecb05132  Salmonella infection
ecb05135  Yersinia infection
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05169  Epstein-Barr virus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05231  Choline metabolism in cancer
ecb05416  Viral myocarditis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100061732 (RAC1)
   04014 Ras signaling pathway
    100061732 (RAC1)
   04015 Rap1 signaling pathway
    100061732 (RAC1)
   04310 Wnt signaling pathway
    100061732 (RAC1)
   04370 VEGF signaling pathway
    100061732 (RAC1)
   04071 Sphingolipid signaling pathway
    100061732 (RAC1)
   04024 cAMP signaling pathway
    100061732 (RAC1)
   04151 PI3K-Akt signaling pathway
    100061732 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100061732 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100061732 (RAC1)
   04520 Adherens junction
    100061732 (RAC1)
   04530 Tight junction
    100061732 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100061732 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100061732 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    100061732 (RAC1)
   04662 B cell receptor signaling pathway
    100061732 (RAC1)
   04664 Fc epsilon RI signaling pathway
    100061732 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    100061732 (RAC1)
   04670 Leukocyte transendothelial migration
    100061732 (RAC1)
   04062 Chemokine signaling pathway
    100061732 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100061732 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100061732 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    100061732 (RAC1)
   04380 Osteoclast differentiation
    100061732 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100061732 (RAC1)
   05205 Proteoglycans in cancer
    100061732 (RAC1)
   05203 Viral carcinogenesis
    100061732 (RAC1)
   05231 Choline metabolism in cancer
    100061732 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100061732 (RAC1)
   05212 Pancreatic cancer
    100061732 (RAC1)
   05211 Renal cell carcinoma
    100061732 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100061732 (RAC1)
   05020 Prion disease
    100061732 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100061732 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100061732 (RAC1)
   05416 Viral myocarditis
    100061732 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100061732 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100061732 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100061732 (RAC1)
   05135 Yersinia infection
    100061732 (RAC1)
   05100 Bacterial invasion of epithelial cells
    100061732 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100061732 (RAC1)
   05163 Human cytomegalovirus infection
    100061732 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100061732 (RAC1)
   05169 Epstein-Barr virus infection
    100061732 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100061732 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100061732 (RAC1)
   04031 GTP-binding proteins [BR:ecb04031]
    100061732 (RAC1)
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100061732 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100061732 (RAC1)
  Macropinocytosis
   Ras GTPases
    100061732 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100061732 (RAC1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100061732 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   100061732 (RAC1)
  Exosomal proteins of colorectal cancer cells
   100061732 (RAC1)
  Exosomal proteins of bladder cancer cells
   100061732 (RAC1)
GTP-binding proteins [BR:ecb04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100061732 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 100061732
NCBI-ProteinID: XP_023511007
VGNC: 51221
LinkDB
Position
13
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPMADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaagacgtgcctgctg
atcagttacacgaccaatgcgtttcccggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttgtgggatacagctgga
caagaagattacgacagattgcgtcccctctcctacccgcaaacagttggagaaacgtat
ggtaaggatataacctccaggggcaaagacaagccgatggccgacgtcttcttaatttgc
ttttctcttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaagtg
cgacaccattgtcccaacactcccatcatcctggtggggactaaacttgatcttagggat
gacaaggacacgatcgagaaactgaaggagaagaagctgactcccatcacctacccgcag
ggcctagccatggccaaggagatcggtgctgtcaaatacctggagtgctcggcgctcaca
cagcgaggcctcaagacagtgttcgatgaagctattcgagcggtcctctgcccgcctccc
gtcaagaagaggaagaggaaatgcctgctgctgtga

DBGET integrated database retrieval system